Mouse anti-Human PLEKHG5 Monoclonal Antibody | anti-PLEKHG5 antibody

PLEKHG5 (Pleckstrin Homology Domain Containing Family G Member 5, PH Domain-containing Family G Member 5, Guanine Nucleotide Exchange Factor 720, GEF720, KIAA0720) APC

Cat. Num. AAA6138305

• Gene Names: PLEKHG5; Syx; Tech; DSMA4; CMTRIC; GEF720
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PLEKHG5; Monoclonal Antibody; PLEKHG5 (Pleckstrin Homology Domain Containing Family G Member 5; PH Domain-containing Family G Member 5; Guanine Nucleotide Exchange Factor 720; GEF720; KIAA0720) APC; anti-PLEKHG5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5A9
• Specificity: Recognizes human PLEKHG5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 1006

• Applicable Applications for anti-PLEKHG5 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.5ug/ml; IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa896-996 from human PLEKHG5 (NP_065682) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCLAGEPAGSHRKRCGDLPSGASPRVQPEPPPGVSAQHRKLTLAQLYRIRTTL
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PLEKHG5 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PLEKHG5 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged PLEKHG5 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-PLEKHG5 antibody

Antibodies; Pleckstrin Homology Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 38373682
• NCBI GeneID: 57449
• NCBI Accession #: NP_065682
• NCBI GenBank Nucleotide #: NM_020631
• UniProt Accession #: O94827
• NCBI Official Full Name: pleckstrin homology domain-containing family G member 5 isoform a
• NCBI Official Synonym Full Names: pleckstrin homology and RhoGEF domain containing G5
• NCBI Official Symbol: PLEKHG5
• NCBI Official Synonym Symbols: Syx; Tech; DSMA4; CMTRIC; GEF720
• NCBI Protein Information: pleckstrin homology domain-containing family G member 5
• UniProt Protein Name: Pleckstrin homology domain-containing family G member 5
• Protein Family: Pleckstrin homology domain-containing family
• UniProt Gene Name: PLEKHG5
• UniProt Synonym Gene Names: KIAA0720; PH domain-containing family G member 5; GEF720

NCBI Description

This gene encodes a protein that activates the nuclear factor kappa B (NFKB1) signaling pathway. Mutations in this gene are associated with autosomal recessive distal spinal muscular atrophy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]

Uniprot Description

PLEKHG5: Activates the NF-kappa-B signaling pathway and RHOA. Appears to be involved in the control of neuronal cell differentiation. Defects in PLEKHG5 are the cause of distal spinal muscular atrophy autosomal recessive type 4 (DSMA4). Distal spinal muscular atrophy, also known as distal hereditary motor neuronopathy, represents a heterogeneous group of neuromuscular disorders caused by selective degeneration of motor neurons in the anterior horn of the spinal cord, without sensory deficit in the posterior horn. The overall clinical picture consists of a classical distal muscular atrophy syndrome in the legs without clinical sensory loss. The disease starts with weakness and wasting of distal muscles of the anterior tibial and peroneal compartments of the legs. Later on, weakness and atrophy may expand to the proximal muscles of the lower limbs and/or to the distal upper limbs. DSMA4 is characterized by childhood onset, generalized muscle weakness and atrophy with denervation and normal sensation. Bulbar symptoms and pyramidal signs are absent. 5 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1p36.31

Cellular Component: cytoplasm; cytosol; endocytic vesicle; intercellular junction; lamellipodium; perinuclear region of cytoplasm; plasma membrane

Molecular Function: guanyl-nucleotide exchange factor activity; Rho guanyl-nucleotide exchange factor activity; signal transducer activity

Biological Process: positive regulation of apoptosis; positive regulation of GTPase activity; positive regulation of I-kappaB kinase/NF-kappaB signaling; regulation of Rho protein signal transduction; regulation of small GTPase mediated signal transduction; signal transduction

Disease: Charcot-marie-tooth Disease, Recessive Intermediate C; Spinal Muscular Atrophy, Distal, Autosomal Recessive, 4