Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GMPR expression in transfected 293T cell line by GMPR polyclonal antibody. Lane 1: GMPR transfected lysate (37.95kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human GMPR Polyclonal Antibody | anti-GMPR antibody

GMPR (Guanosine Monophosphate Reductase, Guanosine 5'-monophosphate Oxidoreductase 1, Guanosine Monophosphate Reductase 1, GMP Reductase 1, GMPR1)

Gene Names
GMPR; GMPR1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
GMPR; Polyclonal Antibody; GMPR (Guanosine Monophosphate Reductase; Guanosine 5'-monophosphate Oxidoreductase 1; Guanosine Monophosphate Reductase 1; GMP Reductase 1; GMPR1); Anti -GMPR (Guanosine Monophosphate Reductase; anti-GMPR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GMPR.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS
Applicable Applications for anti-GMPR antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human GMPR, aa1-345 (NP_006868.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GMPR expression in transfected 293T cell line by GMPR polyclonal antibody. Lane 1: GMPR transfected lysate (37.95kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GMPR expression in transfected 293T cell line by GMPR polyclonal antibody. Lane 1: GMPR transfected lysate (37.95kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GMPR antibody
Guanosine monophosphate reductase (EC 1.7.1.7) catalyzes the irreversible NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). GMPR is able to convert guanosine nucleotides to the pivotal precursor of both guanine (G) and adenine (A) nucleotides. It plays an important role in maintaining the intracellular balance of A and G nucleotides.
Product Categories/Family for anti-GMPR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,419 Da
NCBI Official Full Name
GMP reductase 1
NCBI Official Synonym Full Names
guanosine monophosphate reductase
NCBI Official Symbol
GMPR
NCBI Official Synonym Symbols
GMPR1
NCBI Protein Information
GMP reductase 1; guanine monophosphate reductase; guanosine monophosphate reductase 1; guanosine 5'-monophosphate oxidoreductase 1
UniProt Protein Name
GMP reductase 1
Protein Family
UniProt Gene Name
GMPR
UniProt Synonym Gene Names
GMPR1; Guanosine monophosphate reductase 1
UniProt Entry Name
GMPR1_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of GMP to IMP. The protein also functions in the re-utilization of free intracellular bases and purine nucleosides.[provided by RefSeq, Oct 2009]

Uniprot Description

GMPR: Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. Belongs to the IMPDH/GMPR family.

Protein type: Nucleotide Metabolism - purine; Oxidoreductase; EC 1.7.1.7

Chromosomal Location of Human Ortholog: 6p23

Cellular Component: cytosol

Molecular Function: GMP reductase activity; metal ion binding

Biological Process: nucleobase, nucleoside and nucleotide metabolic process; nucleotide metabolic process; response to cold; purine base metabolic process; purine salvage

Research Articles on GMPR

Similar Products

Product Notes

The GMPR gmpr (Catalog #AAA6003623) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GMPR (Guanosine Monophosphate Reductase, Guanosine 5'-monophosphate Oxidoreductase 1, Guanosine Monophosphate Reductase 1, GMP Reductase 1, GMPR1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GMPR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the GMPR gmpr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPRIDADLKL DFKDVLLRPK RSSLKSRAEV DLERTFTFRN SKQTYSGIPI IVANMDTVGT FEMAAVMSQH SMFTAIHKHY SLDDWKLFAT NHPECLQNVA VSSGSGQNDL EKMTSILEAV PQVKFICLDV ANGYSEHFVE FVKLVRAKFP EHTIMAGNVV TGEMVEELIL SGADIIKVGV GPGSVCTTRT KTGVGYPQLS AVIECADSAH GLKGHIISDG GCTCPGDVAK AFGAGADFVM LGGMFSGHTE CAGEVIERNG RKLKLFYGMS SDTAMNKHAG GVAEYRASEG KTVEVPYKGD VENTILDILG GLRSTCTYVG AAKLKELSRR ATFIRVTQQH NTVFS. It is sometimes possible for the material contained within the vial of "GMPR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.