Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC2A6 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-GLUT6 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, which contains 12 transmembrane domains and a number of critical conserved residues.Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, that contain 12 transmembrane domains and a number of critical conserved residues.
Cross-Reactivity
Human
Immunogen
GLUT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTKSQASWFGSV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(GLUT6 antibody (MBS5300579) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-GLUT6 antibody
The GLUT6 (Catalog #AAA5300579) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GLUT6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the GLUT6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process.
It is sometimes possible for the material contained within the vial of
"GLUT6, Polyclonal Antibody" to become dispersed throughout the inside of
the vial, particularly around the seal of said vial, during shipment and storage. We always
suggest centrifuging these vials
to consolidate all of the liquid away from the lid and to the bottom of the vial prior to
opening. Please be advised that
certain products may require dry ice for shipping and that, if this is the case, an
additional dry ice fee may also be
required.
Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are
absolutely not suitable for use in any
sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a
product from AAA Biotech, you
are explicitly certifying that said products will be properly tested and used in line with
industry standard. AAA Biotech
and its authorized distribution partners reserve the right to refuse to fulfill any order if
we have any indication that a
purchaser may be intending to use a product outside of our accepted criteria.
Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech
cannot be held
responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any
aspect of this datasheet at
any time and without notice. It is the responsibility of the customer to inform AAA Biotech
of any product performance
issues observed or experienced within 30 days of receipt of said product. To see additional
details on this or any of our
other policies, please see our Terms & Conditions page.