Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GLUT5 antibody (MBS5301950) used at 1 ug/ml to detect target protein.)

Rabbit GLUT5 Polyclonal Antibody | anti-GLUT5 antibody

GLUT5 antibody

Gene Names
SLC2A5; GLUT5; GLUT-5
Applications
Western Blot
Purity
Affinity purified
Synonyms
GLUT5; Polyclonal Antibody; GLUT5 antibody; Polyclonal GLUT5; Anti-GLUT5; Glucose transporter 5; GLUT 5; GLUT-5; Solute Carrier Family 2 Member 5; Facilitated Glucose/Fructose Transporter 5; SLC2A5; anti-GLUT5 antibody
Ordering
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC2A5 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
501
Applicable Applications for anti-GLUT5 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SLC2A5 is a cytochalasin B-sensitive carrier. It seems to function primarily as a fructose transporter.
Cross-Reactivity
Human
Immunogen
GLUT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGF
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(GLUT5 antibody (MBS5301950) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (GLUT5 antibody (MBS5301950) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-GLUT5 antibody
Rabbit polyclonal GLUT5 antibody
Product Categories/Family for anti-GLUT5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
55 kDa (MW of target protein)
NCBI Official Full Name
GLUT5 protein
NCBI Official Synonym Full Names
solute carrier family 2 (facilitated glucose/fructose transporter), member 5
NCBI Official Symbol
SLC2A5
NCBI Official Synonym Symbols
GLUT5; GLUT-5
NCBI Protein Information
solute carrier family 2, facilitated glucose transporter member 5
UniProt Protein Name
Solute carrier family 2, facilitated glucose transporter member 5
UniProt Gene Name
SLC2A5
UniProt Synonym Gene Names
GLUT5; GLUT-5
UniProt Entry Name
GTR5_HUMAN

Uniprot Description

GLUT5: an integral membrane facilitative glucose transporter. One of 13 members of the human equilibrative glucose transport protein family. Plays an important role in fructose absorption by the intestine. Expressed primarily in the jejunal region of the small intestine. Expressed at low levels in human kidney, skeletal muscle, adipocytes, microglial cells and in the human blood-brain barrier.

Protein type: Transporter; Membrane protein, multi-pass; Transporter, SLC family; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36.2

Cellular Component: apical plasma membrane; integral to membrane; plasma membrane

Molecular Function: fructose transmembrane transporter activity; glucose transmembrane transporter activity

Biological Process: hexose transport; fructose transport; carbohydrate metabolic process; pathogenesis; glucose transport; transmembrane transport

Research Articles on GLUT5

Similar Products

Product Notes

The GLUT5 slc2a5 (Catalog #AAA5301950) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GLUT5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the GLUT5 slc2a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GLUT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.