Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using GJA5 antibody. Blue: DAPI for nuclear staining.)

Rabbit anti-Human GJA5 Polyclonal Antibody | anti-GJA5 antibody

GJA5 Polyclonal Antibody

Gene Names
GJA5; CX40; ATFB11
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
GJA5; Polyclonal Antibody; GJA5 Polyclonal Antibody; ATFB11; CX40; anti-GJA5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
Sequence Length
358
Applicable Applications for anti-GJA5 antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human GJA5
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell junction, Cell membrane, Multi-pass membrane protein, gap junction
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence analysis of HeLa cells using GJA5 antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using GJA5 antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-GJA5 antibody
This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene may be associated with atrial fibrillation. Alternatively spliced transcript variants encoding the same isoform have been described.
Product Categories/Family for anti-GJA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
gap junction alpha-5 protein
NCBI Official Synonym Full Names
gap junction protein alpha 5
NCBI Official Symbol
GJA5
NCBI Official Synonym Symbols
CX40; ATFB11
NCBI Protein Information
gap junction alpha-5 protein
UniProt Protein Name
Gap junction alpha-5 protein
UniProt Gene Name
GJA5
UniProt Synonym Gene Names
Cx40

NCBI Description

This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene may be associated with atrial fibrillation. Alternatively spliced transcript variants encoding the same isoform have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Research Articles on GJA5

Similar Products

Product Notes

The GJA5 gja5 (Catalog #AAA9133534) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GJA5 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GJA5 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the GJA5 gja5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGWKKIRQRF VKPRQHMAKC QLSGPSVGIV QSCTPPPDFN QCLENGPGGK FFNPFSNNMA SQQNTDNLVT EQVRGQEQTP GEGFIQVRYG QKPEVPNGVS PGHRLPHGYH SDKRRLSKAS SKARSDDLSV. It is sometimes possible for the material contained within the vial of "GJA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.