Western Blot (WB)
(WB Suggested Anti-GIPC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Rabbit GIPC3 Polyclonal Antibody | anti-GIPC3 antibody
GIPC3 antibody - middle region
Gene Names
GIPC3; DFNB15; DFNB72; DFNB95; C19orf64
Reactivity
Dog, Guinea Pig, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GIPC3; Polyclonal Antibody; GIPC3 antibody - middle region; anti-GIPC3 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLRLRSGGAATVEEAPSEFEEEASRKVDDLLESYMGIRDPELASTMVETS
Sequence Length
312
Applicable Applications for anti-GIPC3 antibody
Western Blot (WB)
Homology
Dog: 92%; Guinea Pig: 85%; Human: 100%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GIPC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-GIPC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-GIPC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-GIPC3 antibody
This is a rabbit polyclonal antibody against GIPC3. It was validated on Western Blot
Target Description: The function of GIPC3 remains unknown.
Target Description: The function of GIPC3 remains unknown.
Product Categories/Family for anti-GIPC3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
PDZ domain-containing protein GIPC3
NCBI Official Synonym Full Names
GIPC PDZ domain containing family member 3
NCBI Official Symbol
GIPC3
NCBI Official Synonym Symbols
DFNB15; DFNB72; DFNB95; C19orf64
NCBI Protein Information
PDZ domain-containing protein GIPC3
UniProt Protein Name
PDZ domain-containing protein GIPC3
Protein Family
UniProt Gene Name
GIPC3
UniProt Synonym Gene Names
C19orf64
UniProt Entry Name
GIPC3_HUMAN
NCBI Description
The protein encoded by this gene belongs to the GIPC family. Studies in mice suggest that this gene is required for postnatal maturation of the hair bundle and long-term survival of hair cells and spiral ganglion in the ear. Mutations in this gene are associated with autosomal recessive deafness. [provided by RefSeq, Dec 2011]
Research Articles on GIPC3
Similar Products
Product Notes
The GIPC3 gipc3 (Catalog #AAA3205763) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GIPC3 antibody - middle region reacts with Dog, Guinea Pig, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GIPC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GIPC3 gipc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLRLRSGGAA TVEEAPSEFE EEASRKVDDL LESYMGIRDP ELASTMVETS. It is sometimes possible for the material contained within the vial of "GIPC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
