Immunohistochemistry (IHC)
(Human Intestine)
Rabbit GIOT-1 Polyclonal Antibody | anti-ZNF461 antibody
GIOT-1 antibody - N-terminal region
Gene Names
ZNF461; GIOT1; HZF28; GIOT-1
Reactivity
Dog, Horse, Human
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
GIOT-1; Polyclonal Antibody; GIOT-1 antibody - N-terminal region; anti-ZNF461 antibody
Host
Rabbit
Reactivity
Dog, Horse, Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFS
Sequence Length
436
Applicable Applications for anti-ZNF461 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Dog: 92%; Horse: 85%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GIOT-1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Intestine)
Immunohistochemistry (IHC)
(Human Intestine)
Western Blot (WB)
(WB Suggested Anti-GIOT-1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)
Western Blot (WB)
(WB Suggested Anti-GIOT-1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)
Related Product Information for anti-ZNF461 antibody
This is a rabbit polyclonal antibody against GIOT-1. It was validated on Western Blot and immunohistochemistry
Target Description: Gonadotropins are essential for ovarian follicular development and differentiation. Gene expression of GIOT1 is restricted to the pituitary, adrenal, testis, and ovary. The kruppel-associated box-A domain of GIOT1 is responsible for transcriptional repressor activity.
Target Description: Gonadotropins are essential for ovarian follicular development and differentiation. Gene expression of GIOT1 is restricted to the pituitary, adrenal, testis, and ovary. The kruppel-associated box-A domain of GIOT1 is responsible for transcriptional repressor activity.
Product Categories/Family for anti-ZNF461 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
zinc finger protein 461 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 461
NCBI Official Symbol
ZNF461
NCBI Official Synonym Symbols
GIOT1; HZF28; GIOT-1
NCBI Protein Information
zinc finger protein 461
UniProt Protein Name
Zinc finger protein 461
Protein Family
UniProt Gene Name
ZNF461
UniProt Synonym Gene Names
GIOT1; GIOT-1
UniProt Entry Name
ZN461_HUMAN
Uniprot Description
ZNF461: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Nuclear receptor co-regulator; C2H2-type zinc finger protein
Chromosomal Location of Human Ortholog: 19q13.12
Cellular Component: nucleus
Molecular Function: DNA binding; metal ion binding; transcription factor activity
Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent
Research Articles on ZNF461
Similar Products
Product Notes
The ZNF461 znf461 (Catalog #AAA3203025) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GIOT-1 antibody - N-terminal region reacts with Dog, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's GIOT-1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ZNF461 znf461 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QHQGQEEGYF RQLMINHENM PIFSQHTLLT QEFYDREKIS ECKKCRKIFS. It is sometimes possible for the material contained within the vial of "GIOT-1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
