Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GIMAP5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Rabbit GIMAP5 Polyclonal Antibody | anti-GIMAP5 antibody

GIMAP5 antibody - middle region

Gene Names
GIMAP5; IAN4; IAN5; IROD; IAN-5; IMAP3; HIMAP3; IAN4L1
Reactivity
Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GIMAP5; Polyclonal Antibody; GIMAP5 antibody - middle region; anti-GIMAP5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL
Sequence Length
307
Applicable Applications for anti-GIMAP5 antibody
Western Blot (WB)
Homology
Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GIMAP5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GIMAP5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-GIMAP5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-GIMAP5 antibody
This is a rabbit polyclonal antibody against GIMAP5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GIMAP5 belongs to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
GTPase IMAP family member 5
NCBI Official Synonym Full Names
GTPase, IMAP family member 5
NCBI Official Symbol
GIMAP5
NCBI Official Synonym Symbols
IAN4; IAN5; IROD; IAN-5; IMAP3; HIMAP3; IAN4L1
NCBI Protein Information
GTPase IMAP family member 5
UniProt Protein Name
GTPase IMAP family member 5
Protein Family
UniProt Gene Name
GIMAP5
UniProt Synonym Gene Names
IAN4L1; IAN5; IMAP3; IAN-5; hIAN5
UniProt Entry Name
GIMA5_HUMAN

NCBI Description

This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene encodes an antiapoptotic protein that functions in T-cell survival. Polymorphisms in this gene are associated with systemic lupus erythematosus. Read-through transcription exists between this gene and the neighboring upstream GIMAP1 (GTPase, IMAP family member 1) gene. [provided by RefSeq, Dec 2010]

Uniprot Description

GIMAP5: Required for mitochondrial integrity and T-cell survival. May contribute to T-cell quiescence. Belongs to the IAN GTP-binding protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Apoptosis; Mitochondrial; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q36.1

Cellular Component: mitochondrial outer membrane; lysosome; integral to membrane

Molecular Function: GTP binding

Research Articles on GIMAP5

Similar Products

Product Notes

The GIMAP5 gimap5 (Catalog #AAA3208575) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GIMAP5 antibody - middle region reacts with Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GIMAP5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GIMAP5 gimap5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CERRYCAFNN WGSVEEQRQQ QAELLAVIER LGREREGSFH SNDLFLDAQL. It is sometimes possible for the material contained within the vial of "GIMAP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.