Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human GIMAP5 Monoclonal Antibody | anti-GIMAP5 antibody

GIMAP5 (GTPase IMAP Family Member 5, Immunity-associated Nucleotide 4-like 1 Protein, IAN4L1, Immunity-associated Nucleotide 5 Protein, hIAN5, IAN-5, Immunity-associated Protein 3, IMAP3, FLJ11296) APC

Gene Names
GIMAP5; IAN4; IAN5; IROD; IAN-5; IMAP3; HIMAP3; IAN4L1
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GIMAP5; Monoclonal Antibody; GIMAP5 (GTPase IMAP Family Member 5; Immunity-associated Nucleotide 4-like 1 Protein; IAN4L1; Immunity-associated Nucleotide 5 Protein; hIAN5; IAN-5; Immunity-associated Protein 3; IMAP3; FLJ11296) APC; anti-GIMAP5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E10
Specificity
Recognizes human GIMAP5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-GIMAP5 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa186-285 from human GIMAP5 (NP_060854) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVKHLMLLHYE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of GIMAP5 transfected lysate using GIMAP5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GIMAP5 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of GIMAP5 transfected lysate using GIMAP5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GIMAP5 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged GIMAP5 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GIMAP5 is 1ng/ml as a capture antibody.)
Related Product Information for anti-GIMAP5 antibody
GIMAP5 is a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins.
Product Categories/Family for anti-GIMAP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,846 Da
NCBI Official Full Name
GTPase IMAP family member 5
NCBI Official Synonym Full Names
GTPase, IMAP family member 5
NCBI Official Symbol
GIMAP5
NCBI Official Synonym Symbols
IAN4; IAN5; IROD; IAN-5; IMAP3; HIMAP3; IAN4L1
NCBI Protein Information
GTPase IMAP family member 5; immunity associated protein 3; immune associated nucleotide 4 like 1; immunity-associated nucleotide 5 protein; inhibitor of radiation- and OA-induced apoptosis, Irod/Ian5
UniProt Protein Name
GTPase IMAP family member 5
Protein Family
UniProt Gene Name
GIMAP5
UniProt Synonym Gene Names
IAN4L1; IAN5; IMAP3; IAN-5; hIAN5
UniProt Entry Name
GIMA5_HUMAN

NCBI Description

This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene encodes an antiapoptotic protein that functions in T-cell survival. Polymorphisms in this gene are associated with systemic lupus erythematosus. Read-through transcription exists between this gene and the neighboring upstream GIMAP1 (GTPase, IMAP family member 1) gene. [provided by RefSeq, Dec 2010]

Uniprot Description

GIMAP5: Required for mitochondrial integrity and T-cell survival. May contribute to T-cell quiescence. Belongs to the IAN GTP-binding protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Apoptosis; Mitochondrial; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q36.1

Cellular Component: mitochondrial outer membrane; lysosome; integral to membrane

Molecular Function: GTP binding

Research Articles on GIMAP5

Similar Products

Product Notes

The GIMAP5 gimap5 (Catalog #AAA6136769) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GIMAP5 (GTPase IMAP Family Member 5, Immunity-associated Nucleotide 4-like 1 Protein, IAN4L1, Immunity-associated Nucleotide 5 Protein, hIAN5, IAN-5, Immunity-associated Protein 3, IMAP3, FLJ11296) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GIMAP5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GIMAP5 gimap5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GIMAP5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.