Mouse anti-Human TLR8 Monoclonal Antibody | anti-TLR8 antibody

TLR8 (Toll-like Receptor 8, CD288, UNQ249/PRO286) (PE)

Cat. Num. AAA6160739

• Gene Names: TLR8; CD288
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TLR8; Monoclonal Antibody; TLR8 (Toll-like Receptor 8; CD288; UNQ249/PRO286) (PE); anti-TLR8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4C6
• Specificity: Recognizes human TLR8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-TLR8 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Recombinant corresponding to aa723-825 from human TLR8 (NP_619542) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSD
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.33kD).)

Western Blot (WB)

(TLR8 monoclonal antibody, Western Blot analysis of TLR8 expression in HL-60.)

Western Blot (WB)

(Western Blot analysis of TLR8 expression in transfected 293T cell line by TLR8 monoclonal antibody. Lane 1: TLR8 transfected lysate (121.764kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-TLR8 antibody

Antibodies; Toll Like Receptors (TLR)

NCBI and Uniprot Product Information

• NCBI GI #: 20302168
• NCBI GeneID: 51311
• NCBI Accession #: NP_619542
• NCBI GenBank Nucleotide #: NM_138636
• UniProt Accession #: Q9NR97; Q495P4; Q6UXL6; Q9NYG9; B3Y654; D1CS70; D1CS76
• Molecular Weight: 121,764 Da
• NCBI Official Full Name: toll-like receptor 8 isoform 2
• NCBI Official Synonym Full Names: toll-like receptor 8
• NCBI Official Symbol: TLR8
• NCBI Official Synonym Symbols: CD288
• NCBI Protein Information: toll-like receptor 8
• UniProt Protein Name: Toll-like receptor 8
• Protein Family: Toll-like receptor
• UniProt Gene Name: TLR8
• UniProt Entry Name: TLR8_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung and peripheral blood leukocytes, and lies in close proximity to another family member, TLR7, on chromosome X. [provided by RefSeq, Jul 2008]

Uniprot Description

TLR8: Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Belongs to the Toll-like receptor family.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xp22

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; integral to membrane; endosome membrane

Molecular Function: single-stranded RNA binding; DNA binding; RNA binding; double-stranded RNA binding; drug binding; receptor activity

Biological Process: I-kappaB kinase/NF-kappaB cascade; regulation of cytokine secretion; response to virus; positive regulation of interleukin-8 biosynthetic process; microglial cell activation; positive regulation of interferon-alpha biosynthetic process; toll-like receptor 8 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; positive regulation of innate immune response; positive regulation of interferon-beta biosynthetic process; toll-like receptor signaling pathway; innate immune response; toll-like receptor 9 signaling pathway; immunoglobulin mediated immune response; inflammatory response; defense response to virus; positive regulation of interferon-gamma biosynthetic process