Rabbit anti-Human GCSF Polyclonal Antibody | anti-GCSF antibody

GCSF (Granulocyte Colony-stimulating Factor, G-CSF, Pluripoietin, Filgrastim, Lenograstim, CSF3, C17orf33) APC

Cat. Num. AAA6379638

• Gene Names: CSF3; GCSF; CSF3OS; C17orf33
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GCSF; Polyclonal Antibody; GCSF (Granulocyte Colony-stimulating Factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim; CSF3; C17orf33) APC; anti-GCSF antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CSF3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-GCSF antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CSF3, aa1-207 (NP_000750.1).
• Immunogen Sequence: MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CSF3 expression in transfected 293T cell line by CSF3 polyclonal antibody. Lane 1: CSF3 transfected lysate (22.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-GCSF antibody

Granulocyte-colony Stimulating Factor (G-CSF) is a pleiotropic cytokine that influences differentiation, proliferation and activation of the neutrophilic granulocyte lineage. G-CSF signals via the G-CSF receptor, a heavily glycosylated 812aa polypeptide with a single transmembrane domain. Stimulation of the G-CSFR results in the activation of the Ras/MAPK pathway and phosphorylation of the adaptor protein Shc.

Product Categories/Family for anti-GCSF antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 4503079
• NCBI GeneID: 1440
• NCBI Accession #: NP_000750.1
• NCBI GenBank Nucleotide #: NM_000759
• UniProt Accession #: P09919; A8MXR7
• Molecular Weight: 18,434 Da
• NCBI Official Full Name: granulocyte colony-stimulating factor isoform a
• NCBI Official Synonym Full Names: colony stimulating factor 3 (granulocyte)
• NCBI Official Symbol: CSF3
• NCBI Official Synonym Symbols: GCSF; CSF3OS; C17orf33
• NCBI Protein Information: granulocyte colony-stimulating factor; filgrastim; granulocyte-colony stimulating factor; lenograstim; pluripoietin
• UniProt Protein Name: Granulocyte colony-stimulating factor
• UniProt Gene Name: CSF3
• UniProt Synonym Gene Names: C17orf33; GCSF; G-CSF
• UniProt Entry Name: CSF3_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]

Uniprot Description

G-CSF: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. Belongs to the IL-6 superfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Cell cycle regulation; Cytokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q11.2-q12

Cellular Component: extracellular space

Molecular Function: enzyme binding; growth factor activity; cytokine activity; granulocyte colony-stimulating factor receptor binding

Biological Process: granulocyte differentiation; positive regulation of myeloid cell differentiation; positive regulation of protein binding; multicellular organismal development; cytokine and chemokine mediated signaling pathway; positive regulation of peptidyl-serine phosphorylation; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein kinase B signaling cascade; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of actin filament polymerization; positive regulation of cell proliferation; positive regulation of transcription factor import into nucleus; immune response; positive regulation of transcription from RNA polymerase II promoter