Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CSF3 expression in transfected 293T cell line by CSF3 polyclonal antibody. Lane 1: CSF3 transfected lysate (22.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human GCSF Polyclonal Antibody | anti-GCSF antibody

GCSF (Granulocyte Colony-stimulating Factor, G-CSF, Pluripoietin, Filgrastim, Lenograstim, CSF3, C17orf33) (PE)

Gene Names
CSF3; GCSF; CSF3OS; C17orf33
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GCSF; Polyclonal Antibody; GCSF (Granulocyte Colony-stimulating Factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim; CSF3; C17orf33) (PE); anti-GCSF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CSF3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GCSF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CSF3, aa1-207 (NP_000750.1).
Immunogen Sequence
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CSF3 expression in transfected 293T cell line by CSF3 polyclonal antibody. Lane 1: CSF3 transfected lysate (22.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CSF3 expression in transfected 293T cell line by CSF3 polyclonal antibody. Lane 1: CSF3 transfected lysate (22.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GCSF antibody
Granulocyte-colony Stimulating Factor (G-CSF) is a pleiotropic cytokine that influences differentiation, proliferation and activation of the neutrophilic granulocyte lineage. G-CSF signals via the G-CSF receptor, a heavily glycosylated 812aa polypeptide with a single transmembrane domain. Stimulation of the G-CSFR results in the activation of the Ras/MAPK pathway and phosphorylation of the adaptor protein Shc.
Product Categories/Family for anti-GCSF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,434 Da
NCBI Official Full Name
granulocyte colony-stimulating factor isoform a
NCBI Official Synonym Full Names
colony stimulating factor 3 (granulocyte)
NCBI Official Symbol
CSF3
NCBI Official Synonym Symbols
GCSF; CSF3OS; C17orf33
NCBI Protein Information
granulocyte colony-stimulating factor; filgrastim; granulocyte-colony stimulating factor; lenograstim; pluripoietin
UniProt Protein Name
Granulocyte colony-stimulating factor
UniProt Gene Name
CSF3
UniProt Synonym Gene Names
C17orf33; GCSF; G-CSF
UniProt Entry Name
CSF3_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]

Uniprot Description

G-CSF: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. Belongs to the IL-6 superfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Cell cycle regulation; Cytokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q11.2-q12

Cellular Component: extracellular space

Molecular Function: enzyme binding; growth factor activity; cytokine activity; granulocyte colony-stimulating factor receptor binding

Biological Process: granulocyte differentiation; positive regulation of myeloid cell differentiation; positive regulation of protein binding; multicellular organismal development; cytokine and chemokine mediated signaling pathway; positive regulation of peptidyl-serine phosphorylation; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein kinase B signaling cascade; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of actin filament polymerization; positive regulation of cell proliferation; positive regulation of transcription factor import into nucleus; immune response; positive regulation of transcription from RNA polymerase II promoter

Research Articles on GCSF

Similar Products

Product Notes

The GCSF csf3 (Catalog #AAA6379647) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GCSF (Granulocyte Colony-stimulating Factor, G-CSF, Pluripoietin, Filgrastim, Lenograstim, CSF3, C17orf33) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GCSF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GCSF csf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GCSF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.