Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GCKRSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human GCKR Polyclonal Antibody | anti-GCKR antibody

GCKR Antibody - N-terminal region

Gene Names
GCKR; GKRP; FGQTL5
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GCKR; Polyclonal Antibody; GCKR Antibody - N-terminal region; anti-GCKR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAE
Sequence Length
625
Applicable Applications for anti-GCKR antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GCKR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GCKRSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GCKRSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GCKR antibody
This is a rabbit polyclonal antibody against GCKR. It was validated on Western Blot

Target Description: This gene encodes a protein belonging to the GCKR subfamily of the SIS (Sugar ISomerase) family of proteins. The gene product is a regulatory protein that inhibits glucokinase in liver and pancreatic islet cells by binding non-covalently to form an inactive complex with the enzyme. This gene is considered a susceptibility gene candidate for a form of maturity-onset diabetes of the young (MODY).
Product Categories/Family for anti-GCKR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
glucokinase regulatory protein
NCBI Official Synonym Full Names
glucokinase regulator
NCBI Official Symbol
GCKR
NCBI Official Synonym Symbols
GKRP; FGQTL5
NCBI Protein Information
glucokinase regulatory protein
UniProt Protein Name
Glucokinase regulatory protein
UniProt Gene Name
GCKR
UniProt Synonym Gene Names
Glucokinase regulator
UniProt Entry Name
GCKR_HUMAN

NCBI Description

This gene encodes a protein belonging to the GCKR subfamily of the SIS (Sugar ISomerase) family of proteins. The gene product is a regulatory protein that inhibits glucokinase in liver and pancreatic islet cells by binding non-covalently to form an inactive complex with the enzyme. This gene is considered a susceptibility gene candidate for a form of maturity-onset diabetes of the young (MODY). [provided by RefSeq, Jul 2008]

Uniprot Description

GCKR: a key regulator of glucokinase in the liver and pancreas. Not detected in muscle, brain, heart, thymus, intestine, uterus, adipose tissue, kidney, adrenal, lung or spleen. When expressed alone, both glucokinase and GCKR localize predominantly to the cytoplasm. Co-expression induces both proteins to localize in the nucleus.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 2p23

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; cytosol

Molecular Function: enzyme inhibitor activity; protein domain specific binding; protein binding; enzyme binding; carbohydrate binding

Biological Process: negative regulation of glucokinase activity; urate metabolic process; protein import into nucleus, translocation; hexose transport; carbohydrate metabolic process; cell glucose homeostasis; pathogenesis; glucose transport; transmembrane transport; response to fructose stimulus; positive regulation of glucokinase activity

Disease: Fasting Plasma Glucose Level Quantitative Trait Locus 5

Research Articles on GCKR

Similar Products

Product Notes

The GCKR gckr (Catalog #AAA3219726) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GCKR Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GCKR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GCKR gckr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VIETPEPGKW ELSGYEAAVP ITEKSNPLTQ DLDKADAENI VRLLGQCDAE. It is sometimes possible for the material contained within the vial of "GCKR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.