Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of SLC10A1 using anti- SLC10A1 antibody (MBS177905).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat liver tissue lysates,Lane 2: mouse liver tissue lysates,After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- SLC10A1 antigen affinity purified polyclonal antibody (MBS177905) at 0.5 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (MBS176460) with Tanon 5200 system. A specific band was detected for SLC10A1 at approximately 50KD. The expected band size for SLC10A1 is at 38KD.)

Rabbit anti-Mouse, Rat SLC10A1 Polyclonal Antibody | anti-SLC10A1 antibody

Anti-SLC10A1 Antibody

Gene Names
Slc10a1; Ntcp
Reactivity
Mouse, Rat
Applications
Flow Cytometry, Functional Assay, Immunofluorescence, Immunohistochemistry, Immunohistochemistry, Immunocytochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
SLC10A1; Polyclonal Antibody; Anti-SLC10A1 Antibody; Sodium/bile acid cotransporter; anti-SLC10A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized; Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Applicable Applications for anti-SLC10A1 antibody
Flow Cytometry (FC/FACS), Immunofluorescence (IF), Immunohistochemistry-Paraffin (IHC-P), Immunohistochemistry-Frozen (IHC-F), Immunocytochemistry (ICC), Western Blot (WB)
Application Notes
Western Blot (WB) -
Concentration: 0.1-0.5ug/ml

Immunohistochemistry (IHC)-
Concentration: 0.5-1ug/ml
Antigen Retrieval: By Heat

Immunohistochemistry-Frozen (IHC-F)-
Concentration: 0.5-1ug/ml

Immunocytochemistry (ICC)-
Concentration: 0.5-1g/ml

Flow Cytometry (FC)-
Concentration: 1-3ug/1x106 cells

Immunofluorescence (IF)-
Concentration: 2ug/ml

Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.

Relevant Detection Systems: There are series of assays reacted with primary antibodies. Antibody can be supported by chemiluminscence kit (MBS176460) in WB, supported by MBS176451 in IHC-P, IHC-F, and ICC.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK), different from the related human sequence by eighteen amino acids, and from the related rat sequence by three amino acids.
Reconstitution
0.2mL of distilled water will yeild a concentration of 500ug/ml.
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time.
Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of SLC10A1 using anti- SLC10A1 antibody (MBS177905).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat liver tissue lysates,Lane 2: mouse liver tissue lysates,After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- SLC10A1 antigen affinity purified polyclonal antibody (MBS177905) at 0.5 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (MBS176460) with Tanon 5200 system. A specific band was detected for SLC10A1 at approximately 50KD. The expected band size for SLC10A1 is at 38KD.)

Western Blot (WB) (Western blot analysis of SLC10A1 using anti- SLC10A1 antibody (MBS177905).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat liver tissue lysates,Lane 2: mouse liver tissue lysates,After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- SLC10A1 antigen affinity purified polyclonal antibody (MBS177905) at 0.5 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (MBS176460) with Tanon 5200 system. A specific band was detected for SLC10A1 at approximately 50KD. The expected band size for SLC10A1 is at 38KD.)

Immunofluorescence (IF)

(IF analysis of SLC10A1 using anti- SLC10A1 antibody (MBS177905).SLC10A1 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/mL rabbit anti- SLC10A1 Antibody (MBS177905) overnight at 4°C. DyLight®550 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

Immunofluorescence (IF) (IF analysis of SLC10A1 using anti- SLC10A1 antibody (MBS177905).SLC10A1 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/mL rabbit anti- SLC10A1 Antibody (MBS177905) overnight at 4°C. DyLight®550 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

Immunofluorescence (IF)

(IF analysis of SLC10A1 using anti- SLC10A1 antibody (MBS177905).SLC10A1 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/mL rabbit anti- SLC10A1 Antibody (MBS177905) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

Immunofluorescence (IF) (IF analysis of SLC10A1 using anti- SLC10A1 antibody (MBS177905).SLC10A1 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/mL rabbit anti- SLC10A1 Antibody (MBS177905) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

Flow Cytometry (FC/FACS)

(Flow Cytometry analysis of BRL cells using anti-SLC10A1 antibody (MBS177905). Overlay histogram showing BRL cells stained with MBS177905 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-SLC10A1 Antibody (MBS177905,1ug/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Flow Cytometry (FC/FACS) (Flow Cytometry analysis of BRL cells using anti-SLC10A1 antibody (MBS177905). Overlay histogram showing BRL cells stained with MBS177905 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-SLC10A1 Antibody (MBS177905,1ug/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Immunohistochemistry (IHC)

(IHC analysis of SLC10A1 using anti-SLC10A1 antibody (MBS177905).SLC10A1 was detected in frozen section of mouse liver tissue. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-SLC10A1 Antibody (MBS177905) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(MBS176451) with DAB as the chromogen.)

Immunohistochemistry (IHC) (IHC analysis of SLC10A1 using anti-SLC10A1 antibody (MBS177905).SLC10A1 was detected in frozen section of mouse liver tissue. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-SLC10A1 Antibody (MBS177905) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(MBS176451) with DAB as the chromogen.)

Immunohistochemistry (IHC)

(IHC analysis of SLC10A1 using anti-SLC10A1 antibody (MBS177905). SLC10A1 was detected in paraffin-embedded section of Human Liver Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- SLC10A1 Antibody (MBS177905) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(MBS176451) with DAB as the chromogen.)

Immunohistochemistry (IHC) (IHC analysis of SLC10A1 using anti-SLC10A1 antibody (MBS177905). SLC10A1 was detected in paraffin-embedded section of Human Liver Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- SLC10A1 Antibody (MBS177905) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(MBS176451) with DAB as the chromogen.)

Immunohistochemistry (IHC)

(IHC analysis of SLC10A1 using anti-SLC10A1 antibody (MBS177905).SLC10A1 was detected in paraffin-embedded section of Rat Liver Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-SLC10A1 Antibody (MBS177905) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(MBS176451) with DAB as the chromogen.)

Immunohistochemistry (IHC) (IHC analysis of SLC10A1 using anti-SLC10A1 antibody (MBS177905).SLC10A1 was detected in paraffin-embedded section of Rat Liver Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-SLC10A1 Antibody (MBS177905) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(MBS176451) with DAB as the chromogen.)

Immunohistochemistry (IHC)

(IHC analysis of SLC10A1 using anti-SLC10A1 antibody (MBS177905).SLC10A1 was detected in paraffin-embedded section of Mouse Liver Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-SLC10A1 Antibody (MBS177905) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(MBS176451) with DAB as the chromogen.)

Immunohistochemistry (IHC) (IHC analysis of SLC10A1 using anti-SLC10A1 antibody (MBS177905).SLC10A1 was detected in paraffin-embedded section of Mouse Liver Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-SLC10A1 Antibody (MBS177905) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(MBS176451) with DAB as the chromogen.)

Western Blot (WB)

(Western blot analysis of SLC10A1 using anti- SLC10A1 antibody (MBS177905).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysates (positive control), Lane 2: rat kidney tissue lysates, (negative control)After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC10A1 antigen affinity purified polyclonal antibody (MBS177905) at 0.25 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SLC10A1 at approximately 50KD. The expected band size for SLC10A1 is at 38KD.)

Western Blot (WB) (Western blot analysis of SLC10A1 using anti- SLC10A1 antibody (MBS177905).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysates (positive control), Lane 2: rat kidney tissue lysates, (negative control)After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC10A1 antigen affinity purified polyclonal antibody (MBS177905) at 0.25 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SLC10A1 at approximately 50KD. The expected band size for SLC10A1 is at 38KD.)
Related Product Information for anti-SLC10A1 antibody
Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity.

Rabbit IgG polyclonal antibody for Sodium/bile acid cotransporter (SLC10A1) detection. Tested with WB, IHC-P, IHC-F, ICC, FC/FACS, IF in Human; Mouse; Rat.
References
1. Eloranta JJ, Jung D, Kullak-Ublick GA (2006). "The human Na+-taurocholate cotransporting polypeptide gene is activated by glucocorticoid receptor and peroxisome proliferator-activated receptor-gamma coactivator-1alpha, and suppressed by bile acids via a small heterodimer partner-dependent mechanism.". Mol. Endocrinol. 20 (1): 65-79. 2. Ho RH, Leake BF, Roberts RL, et al. (2004). "Ethnicity-dependent polymorphism in Na+-taurocholate cotransporting polypeptide (SLC10A1) reveals a domain critical for bile acid substrate recognition.". J. Biol. Chem. 279 (8): 7213-22.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
sodium/bile acid cotransporter isoform 1
NCBI Official Synonym Full Names
solute carrier family 10 (sodium/bile acid cotransporter family), member 1
NCBI Official Symbol
Slc10a1
NCBI Official Synonym Symbols
Ntcp
NCBI Protein Information
sodium/bile acid cotransporter
UniProt Protein Name
Sodium/bile acid cotransporter
UniProt Gene Name
Slc10a1
UniProt Synonym Gene Names
Ntcp
UniProt Entry Name
NTCP_MOUSE

Uniprot Description

NTCP: The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium. Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter

Cellular Component: basolateral plasma membrane; integral to membrane; integral to plasma membrane; membrane

Molecular Function: bile acid transmembrane transporter activity; bile acid:sodium symporter activity; symporter activity

Biological Process: bile acid and bile salt transport; ion transport; sodium ion transport; transport

Research Articles on SLC10A1

Similar Products

Product Notes

The SLC10A1 slc10a1 (Catalog #AAA177905) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-SLC10A1 Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC10A1 can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS), Immunofluorescence (IF), Immunohistochemistry-Paraffin (IHC-P), Immunohistochemistry-Frozen (IHC-F), Immunocytochemistry (ICC), Western Blot (WB). Western Blot (WB) - Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC)- Concentration: 0.5-1ug/ml Antigen Retrieval: By Heat Immunohistochemistry-Frozen (IHC-F)- Concentration: 0.5-1ug/ml Immunocytochemistry (ICC)- Concentration: 0.5-1g/ml Flow Cytometry (FC)- Concentration: 1-3ug/1x106 cells Immunofluorescence (IF)- Concentration: 2ug/ml Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections. Relevant Detection Systems: There are series of assays reacted with primary antibodies. Antibody can be supported by chemiluminscence kit (MBS176460) in WB, supported by MBS176451 in IHC-P, IHC-F, and ICC. Researchers should empirically determine the suitability of the SLC10A1 slc10a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC10A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.