Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GALT Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit GALT Polyclonal Antibody | anti-GALT antibody

GALT antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GALT; Polyclonal Antibody; GALT antibody - C-terminal region; anti-GALT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET
Sequence Length
379
Applicable Applications for anti-GALT antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GALT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GALT Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-GALT Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-GALT antibody
This is a rabbit polyclonal antibody against GALT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet. The pathophysiology of galactosemia has not been clearly defined. Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet. The pathophysiology of galactosemia has not been clearly defined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-GALT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
galactose-1-phosphate uridylyltransferase isoform 1
NCBI Official Synonym Full Names
galactose-1-phosphate uridylyltransferase
NCBI Official Symbol
GALT
NCBI Protein Information
galactose-1-phosphate uridylyltransferase
UniProt Protein Name
Galactose-1-phosphate uridylyltransferase
Protein Family
UniProt Gene Name
GALT
UniProt Synonym Gene Names
Gal-1-P uridylyltransferase
UniProt Entry Name
GALT_HUMAN

NCBI Description

Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet. The pathophysiology of galactosemia has not been clearly defined. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Uniprot Description

GALT: Defects in GALT are the cause of galactosemia (GALCT). Galactosemia is an inherited disorder of galactose metabolism that causes jaundice, cataracts, and mental retardation. Belongs to the galactose-1-phosphate uridylyltransferase type 1 family.

Protein type: Motility/polarity/chemotaxis; Carbohydrate Metabolism - amino sugar and nucleotide sugar; EC 2.7.7.12; Carbohydrate Metabolism - galactose; Transferase

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: Golgi apparatus; cytosol

Molecular Function: zinc ion binding; UDP-glucose:hexose-1-phosphate uridylyltransferase activity

Biological Process: galactose catabolic process; carbohydrate metabolic process; UDP-glucose catabolic process; galactose metabolic process; pathogenesis

Disease: Galactosemia

Research Articles on GALT

Similar Products

Product Notes

The GALT galt (Catalog #AAA3209029) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GALT antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GALT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GALT galt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLRSATVRKF MVGYEMLAQA QRDLTPEQAA ERLRALPEVH YHLGQKDRET. It is sometimes possible for the material contained within the vial of "GALT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.