Western Blot (WB)
(SULT1A3 monoclonal antibody (M01), clone 1B10 Western Blot analysis of SULT1A3 expression in HepG2 (Cat # L019V1).)
Mouse SULT1A3 Monoclonal Antibody | anti-SULT1A3 antibody
SULT1A3 (Sulfotransferase Family, Cytosolic, 1A, phenol-preferring, Member 3, HAST, HAST3, M-PST, MGC117469, ST1A5, STM, SULT1A4, TL-PST) (PE)
Gene Names
SLX1A-SULT1A3; STM; HAST3; M-PST; ST1A3; TL-PST; SULT1A3
Applications
Western Blot
Purity
Purified
Synonyms
SULT1A3; Monoclonal Antibody; SULT1A3 (Sulfotransferase Family; Cytosolic; 1A; phenol-preferring; Member 3; HAST; HAST3; M-PST; MGC117469; ST1A5; STM; SULT1A4; TL-PST) (PE); Sulfotransferase Family; TL-PST; anti-SULT1A3 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B10
Specificity
Recognizes SULT1A3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
295
Applicable Applications for anti-SULT1A3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SULT1A3 (AAH14471, 1aa-295aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(SULT1A3 monoclonal antibody (M01), clone 1B10 Western Blot analysis of SULT1A3 expression in HepG2 (Cat # L019V1).)
Western Blot (WB)
(SULT1A3 monoclonal antibody (M01), clone 1B10 Western Blot analysis of SULT1A3 expression in HepG2 (Cat # L019V1).)
Testing Data
(Detection limit for recombinant GST tagged SULT1A3 is 1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SULT1A3 is 1 ng/ml as a capture antibody.)
Related Product Information for anti-SULT1A3 antibody
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Exons of this gene overlap with exons of a gene that encodes a protein containing GIY-YIG domains (GIYD1). Multiple alternatively spliced variants that encode the same protein have been described. [provided by RefSeq]
Product Categories/Family for anti-SULT1A3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4
NCBI Official Synonym Full Names
SLX1A-SULT1A3 readthrough (NMD candidate)
NCBI Official Symbol
SLX1A-SULT1A3
NCBI Official Synonym Symbols
STM; HAST3; M-PST; ST1A3; TL-PST; SULT1A3
Protein Family
NCBI Description
This locus represents naturally occurring read-through transcription between the neighboring SLX1A (SLX1 structure-specific endonuclease subunit homolog A) and SULT1A3 (sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3) genes on the short arm of chromosome 16. A duplicate read-through locus also exists between the SLX1B and SULT1A4 genes located approximately 730 kb upstream on the same chromosome. The read-through transcript is a candidate for nonsense-mediated mRNA decay (NMD), and is thus unlikely to produce a protein product. [provided by RefSeq, Feb 2017]
Similar Products
Product Notes
The SULT1A3 (Catalog #AAA6187818) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SULT1A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SULT1A3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SULT1A3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
