Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit Gab1 Polyclonal Antibody | anti-Gab1 antibody

Gab1 CT (Grb2-Associated Binder1) (PE)

Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Western Blot, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Gab1; Polyclonal Antibody; Gab1 CT (Grb2-Associated Binder1) (PE); anti-Gab1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Specific for Gab1. No other known protein shares more than 10 amino acids with the immunizing sequence. Crossreacts with mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-Gab1 antibody
Immunocytochemistry (ICC), Western Blot (WB), Immunoprecipitation (IP)
Application Notes
ICC: 10ug/ml will show positive immunostaining for Gab1 in A431 cells fixed with 4% paraformaldehyde.
WB: 0.5-2ug/ml will detect Gab1 in RIPA lysates from human A431 carcinoma cells; use 20ug per lane for minigels.
IP: 4ug will immunoprecipitate Gab1 from 500mg of a human A431 carcinoma cell RIPA lysate.
Applications are based on unconjugated antibody.
Immunogen
31 residue peptide sequence corresponding to C-terminal residues 664-694 of Gab1, (CQKTLALKSTREAWTDGRQSTESETPAKS-VK).
Conjugate
PE
Positive Control
Non-stimulated A431 cell lysate.
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-Gab1 antibody
Immunoblot Analysis A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-Gab1 (0.5ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system.
Product Categories/Family for anti-Gab1 antibody
References
Holgado-Madruga, M., et al., Nature 379: 560-564, 1996.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76,616 Da
NCBI Official Full Name
GRB2-associated-binding protein 1 isoform b
NCBI Official Synonym Full Names
GRB2-associated binding protein 1
NCBI Official Symbol
GAB1
NCBI Protein Information
GRB2-associated-binding protein 1; GRB2-associated binder 1; growth factor receptor bound protein 2-associated protein 1
UniProt Protein Name
GRB2-associated-binding protein 1
UniProt Gene Name
GAB1
UniProt Entry Name
GAB1_HUMAN

Similar Products

Product Notes

The Gab1 gab1 (Catalog #AAA6477337) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Gab1 CT (Grb2-Associated Binder1) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Gab1 can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Western Blot (WB), Immunoprecipitation (IP). ICC: 10ug/ml will show positive immunostaining for Gab1 in A431 cells fixed with 4% paraformaldehyde. WB: 0.5-2ug/ml will detect Gab1 in RIPA lysates from human A431 carcinoma cells; use 20ug per lane for minigels. IP: 4ug will immunoprecipitate Gab1 from 500mg of a human A431 carcinoma cell RIPA lysate. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the Gab1 gab1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Gab1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.