<
Western Blot (WB)
(Host: RabbitTarget Name: G6PC3Sample Type: HelaAntibody Dilution: 1.0ug/mlG6PC3 is strongly supported by BioGPS gene expression data to be expressed in HeLa)
Rabbit G6PC3 Polyclonal Antibody | anti-G6PC3 antibody
G6PC3 Antibody - N-terminal region
Gene Names
G6PC3; SCN4; UGRP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
G6PC3; Polyclonal Antibody; G6PC3 Antibody - N-terminal region; anti-G6PC3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT
Sequence Length
346
Applicable Applications for anti-G6PC3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 85%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human G6PC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: G6PC3Sample Type: HelaAntibody Dilution: 1.0ug/mlG6PC3 is strongly supported by BioGPS gene expression data to be expressed in HeLa)
Western Blot (WB)
(Host: RabbitTarget Name: G6PC3Sample Type: HelaAntibody Dilution: 1.0ug/mlG6PC3 is strongly supported by BioGPS gene expression data to be expressed in HeLa)
Western Blot (WB)
(Host: RabbitTarget Name: G6PC3Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: G6PC3Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: G6PC3Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: G6PC3Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: G6PC3Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: G6PC3Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-G6PC3 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellG6PC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Western Blot (WB)
(WB Suggested Anti-G6PC3 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellG6PC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-G6PC3 antibody
This is a rabbit polyclonal antibody against G6PC3. It was validated on Western Blot
Target Description: This gene encodes the catalytic subunit of glucose-6-phosphatase (G6Pase). G6Pase is located in the endoplasmic reticulum (ER) and catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the last step of the gluconeogenic and glycogenolytic pathways. Mutations in this gene result in autosomal recessive severe congenital neutropenia. Multiple transcript variants have been found for this gene, only one of which is expected to express a protein.
Target Description: This gene encodes the catalytic subunit of glucose-6-phosphatase (G6Pase). G6Pase is located in the endoplasmic reticulum (ER) and catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the last step of the gluconeogenic and glycogenolytic pathways. Mutations in this gene result in autosomal recessive severe congenital neutropenia. Multiple transcript variants have been found for this gene, only one of which is expected to express a protein.
Product Categories/Family for anti-G6PC3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
glucose-6-phosphatase 3 isoform 1
NCBI Official Synonym Full Names
glucose-6-phosphatase catalytic subunit 3
NCBI Official Symbol
G6PC3
NCBI Official Synonym Symbols
SCN4; UGRP
NCBI Protein Information
glucose-6-phosphatase 3
UniProt Protein Name
Glucose-6-phosphatase 3
Protein Family
UniProt Gene Name
G6PC3
UniProt Synonym Gene Names
UGRP; G-6-Pase 3; G6Pase 3; G6Pase-beta
UniProt Entry Name
G6PC3_HUMAN
NCBI Description
This gene encodes the catalytic subunit of glucose-6-phosphatase (G6Pase). G6Pase is located in the endoplasmic reticulum (ER) and catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the last step of the gluconeogenic and glycogenolytic pathways. Mutations in this gene result in autosomal recessive severe congenital neutropenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Research Articles on G6PC3
Similar Products
Product Notes
The G6PC3 g6pc3 (Catalog #AAA3216482) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The G6PC3 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's G6PC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the G6PC3 g6pc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESGYYSQAPA QVHQFPSSCE TGPGSPSGHC MITGAALWPI MTALSSQVAT. It is sometimes possible for the material contained within the vial of "G6PC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
