Mouse anti-Human FXC1 Polyclonal Antibody | anti-TIMM10B antibody

FXC1 (Mitochondrial Import Inner Membrane Translocase Subunit Tim10 B, Fracture Callus Protein 1, FxC1, Mitochondrial Import Inner Membrane Translocase Subunit Tim9 B, TIMM10B, Tim10b, FXC1, TIM9B, TIMM9B)

Cat. Num. AAA6008978

• Gene Names: TIMM10B; FXC1; Tim9b; TIM10B
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: FXC1; Polyclonal Antibody; FXC1 (Mitochondrial Import Inner Membrane Translocase Subunit Tim10 B; Fracture Callus Protein 1; FxC1; Mitochondrial Import Inner Membrane Translocase Subunit Tim9 B; TIMM10B; Tim10b; TIM9B; TIMM9B); Anti -FXC1 (Mitochondrial Import Inner Membrane Translocase Subunit Tim10 B; anti-TIMM10B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human FXC1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCVGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPSVAAEQPGVSPSGS*

• Applicable Applications for anti-TIMM10B antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human FXC1, aa1-103 (AAH11014.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FXC1 expression in transfected 293T cell line by FXC1 polyclonal antibody. Lane 1: FXC1 transfected lysate (11.33kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-TIMM10B antibody

Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.

Product Categories/Family for anti-TIMM10B antibody

Antibodies; Abs to Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 6524637
• NCBI GeneID: 26515
• UniProt Accession #: Q9Y5J6; Q96FF3
• Molecular Weight: 11,586 Da
• NCBI Official Full Name: FXC1
• NCBI Official Synonym Full Names: translocase of inner mitochondrial membrane 10 homolog B (yeast)
• NCBI Official Symbol: TIMM10B
• NCBI Official Synonym Symbols: FXC1; Tim9b; TIM10B
• NCBI Protein Information: mitochondrial import inner membrane translocase subunit Tim10 B; fracture callus 1 homolog; fracture callus protein 1; mitochondrial import inner membrane translocase subunit Tim9 B
• UniProt Protein Name: Mitochondrial import inner membrane translocase subunit Tim10 B
• Protein Family: Mitochondrial import inner membrane translocase
• UniProt Gene Name: TIMM10B
• UniProt Synonym Gene Names: FXC1; TIM9B; TIMM9B; Tim10b
• UniProt Entry Name: T10B_HUMAN

NCBI Description

FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM, Apr 2004]

Uniprot Description

TIMM10B: Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin- pore translocase that uses the membrane potential as external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space. Belongs to the small Tim family.

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: mitochondrial intermembrane space protein transporter complex; mitochondrial inner membrane; mitochondrial intermembrane space

Molecular Function: metal ion binding

Biological Process: cellular protein metabolic process; cell-matrix adhesion; protein targeting to mitochondrion