Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Mitochondrial import inner membrane translocase subunit Tim10 B Recombinant Protein | TIMM10B recombinant protein

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim10 B

Gene Names
TIMM10B; FXC1; Tim9b; TIM10B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial import inner membrane translocase subunit Tim10 B; Recombinant Human Mitochondrial import inner membrane translocase subunit Tim10 B; Fracture callus protein 1; FxC1; Mitochondrial import inner membrane translocase subunit Tim9 B; TIMM10B; Tim10b; TIMM10B recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-103aa; Full Length
Sequence
MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
Sequence Length
103
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for TIMM10B recombinant protein
Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.
Product Categories/Family for TIMM10B recombinant protein
References
The human family of deafness/dystonia peptide (DDP) related mitochondrial import proteins.Jin H., Kendall E., Freeman T.C., Roberts R.G., Vetrie D.L.P.Genomics 61:259-267(1999) The mitochondrial TIM22 preprotein translocase is highly conserved throughout the eukaryotic kingdom.Bauer M.F., Rothbauer U., Muehlenbein N., Smith R.J.H., Gerbitz K.-D., Neupert W., Brunner M., Hofmann S.FEBS Lett. 464:41-47(1999) A novel gene expressed in human pheochromocytoma.Peng Y., Li Y., Jia J., Xu S., Han Z., Fu G., Chen Z. Role of the deafness dystonia peptide 1 (DDP1) in import of human Tim23 into the inner membrane of mitochondria.Rothbauer U., Hofmann S., Muehlenbein N., Paschen S.A., Gerbitz K.-D., Neupert W., Brunner M., Bauer M.F.J. Biol. Chem. 276:37327-37334(2001) Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria.Muehlenbein N., Hofmann S., Rothbauer U., Bauer M.F.J. Biol. Chem. 279:13540-13546(2004) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.6 kDa
NCBI Official Full Name
mitochondrial import inner membrane translocase subunit Tim10 B
NCBI Official Synonym Full Names
translocase of inner mitochondrial membrane 10 homolog B (yeast)
NCBI Official Symbol
TIMM10B
NCBI Official Synonym Symbols
FXC1; Tim9b; TIM10B
NCBI Protein Information
mitochondrial import inner membrane translocase subunit Tim10 B
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit Tim10 B
UniProt Gene Name
TIMM10B
UniProt Synonym Gene Names
FXC1; TIM9B; TIMM9B; Tim10b
UniProt Entry Name
T10B_HUMAN

NCBI Description

FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM, Apr 2004]

Uniprot Description

TIMM10B: Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin- pore translocase that uses the membrane potential as external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space. Belongs to the small Tim family.

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrial intermembrane space protein transporter complex

Molecular Function: metal ion binding

Biological Process: cell-matrix adhesion; cellular protein metabolic process; protein targeting to mitochondrion

Research Articles on TIMM10B

Similar Products

Product Notes

The TIMM10B timm10b (Catalog #AAA1447126) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-103aa; Full Length. The amino acid sequence is listed below: MERQQQQQQQ LRNLRDFLLV YNRMTELCFQ RCVPSLHHRA LDAEEEACLH SCAGKLIHSN HRLMAAYVQL MPALVQRRIA DYEAASAVPG VAAEQPGVSP SGS. It is sometimes possible for the material contained within the vial of "Mitochondrial import inner membrane translocase subunit Tim10 B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.