Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FTHL17 antibody (MBS5301624) used at 1 ug/ml to detect target protein.)

Rabbit FTHL17 Polyclonal Antibody | anti-FTHL17 antibody

FTHL17 antibody

Gene Names
FTHL17; CT38
Applications
Western Blot
Purity
Affinity purified
Synonyms
FTHL17; Polyclonal Antibody; FTHL17 antibody; Polyclonal FTHL17; Anti-FTHL17; Ferritin Heavy Polypeptide-Like 17; anti-FTHL17 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
FTHL17 antibody was raised against the middle region of FTHL17
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FTHL17 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
183
Applicable Applications for anti-FTHL17 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
This gene is similar to a mouse gene that encodes a ferritin heavy polypeptide-like protein.
Cross-Reactivity
Human
Immunogen
FTHL17 antibody was raised using the middle region of FTHL17 corresponding to a region with amino acids FLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(FTHL17 antibody (MBS5301624) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (FTHL17 antibody (MBS5301624) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-FTHL17 antibody
Rabbit polyclonal FTHL17 antibody raised against the middle region of FTHL17
Product Categories/Family for anti-FTHL17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
21 kDa (MW of target protein)
NCBI Official Full Name
ferritin, heavy polypeptide-like 17
NCBI Official Synonym Full Names
ferritin, heavy polypeptide-like 17
NCBI Official Symbol
FTHL17
NCBI Official Synonym Symbols
CT38
NCBI Protein Information
ferritin heavy polypeptide-like 17
UniProt Protein Name
Ferritin heavy polypeptide-like 17
UniProt Gene Name
FTHL17
UniProt Synonym Gene Names
CT38
UniProt Entry Name
FHL17_HUMAN

NCBI Description

This gene is orthologous to a mouse gene that encodes a ferritin heavy polypeptide-like protein and shows testis-specific expression. [provided by RefSeq, Oct 2009]

Uniprot Description

FTHL17: Belongs to the ferritin family

Chromosomal Location of Human Ortholog: Xp21

Molecular Function: ferric iron binding

Biological Process: cellular iron ion homeostasis; iron ion transport

Similar Products

Product Notes

The FTHL17 fthl17 (Catalog #AAA5301624) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FTHL17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the FTHL17 fthl17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FTHL17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.