Western Blot (WB)
(CARKD antibody (MBS5303321) used at 1 ug/ml to detect target protein.)
Rabbit CARKD Polyclonal Antibody | anti-CARKD antibody
CARKD antibody
Gene Names
CARKD; LP3298
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
CARKD; Polyclonal Antibody; CARKD antibody; Polyclonal CARKD; Anti-CARKD; Carbohydrate Kinase Domain Containing; LP3298; FLJ34548; anti-CARKD antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
CARKD antibody was raised against the middle region of CARKD
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CARKD antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
347
Applicable Applications for anti-CARKD antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of FLJ10769 protein has not been widely studied, and is yet to be fully elucidated.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
CARKD antibody was raised using the middle region of CARKD corresponding to a region with amino acids RLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(CARKD antibody (MBS5303321) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(CARKD antibody (MBS5303321) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CARKD antibody
Rabbit polyclonal CARKD antibody raised against the middle region of CARKD
Product Categories/Family for anti-CARKD antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
41 kDa (MW of target protein)
NCBI Official Full Name
CARKD protein
NCBI Official Synonym Full Names
carbohydrate kinase domain containing
NCBI Official Symbol
CARKD
NCBI Official Synonym Symbols
LP3298
NCBI Protein Information
ATP-dependent (S)-NAD(P)H-hydrate dehydratase
UniProt Protein Name
ATP-dependent (S)-NAD(P)H-hydrate dehydratase
UniProt Gene Name
CARKD
UniProt Entry Name
NNRD_HUMAN
Uniprot Description
CARKD: Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. Belongs to the nnrD/CARKD family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 4.2.1.93
Chromosomal Location of Human Ortholog: 13q34
Cellular Component: mitochondrion
Molecular Function: ATP-dependent NAD(P)H-hydrate dehydratase activity; ATP binding
Biological Process: nicotinamide nucleotide metabolic process
Research Articles on CARKD
Similar Products
Product Notes
The CARKD carkd (Catalog #AAA5303321) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CARKD antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CARKD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CARKD carkd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CARKD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
