Western Blot (WB)
(MNS1 antibody (MBS5300334) used at 1 ug/ml to detect target protein.)
Rabbit MNS1 Polyclonal Antibody | anti-MNS1 antibody
MNS1 antibody
Gene Names
MNS1; SPATA40
Applications
Western Blot
Purity
Affinity purified
Synonyms
MNS1; Polyclonal Antibody; MNS1 antibody; Polyclonal MNS1; Anti-MNS1; MNS-1; Meiosis-Specific Nuclear Structural 1; FLJ11222; MNS 1; anti-MNS1 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
MNS1 antibody was raised against the middle region of MNS1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MNS1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
495
Applicable Applications for anti-MNS1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein.
Cross-Reactivity
Human
Immunogen
MNS1 antibody was raised using the middle region of MNS1 corresponding to a region with amino acids KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(MNS1 antibody (MBS5300334) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(MNS1 antibody (MBS5300334) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-MNS1 antibody
Rabbit polyclonal MNS1 antibody raised against the middle region of MNS1
Product Categories/Family for anti-MNS1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60 kDa (MW of target protein)
NCBI Official Full Name
meiosis-specific nuclear structural protein 1
NCBI Official Synonym Full Names
meiosis-specific nuclear structural 1
NCBI Official Symbol
MNS1
NCBI Official Synonym Symbols
SPATA40
NCBI Protein Information
meiosis-specific nuclear structural protein 1
UniProt Protein Name
Meiosis-specific nuclear structural protein 1
Protein Family
UniProt Gene Name
MNS1
UniProt Entry Name
MNS1_HUMAN
NCBI Description
This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein. The mouse protein was shown to be expressed at the pachytene stage during spermatogenesis and may function as a nuclear skeletal protein to regulate nuclear morphology during meiosis. [provided by RefSeq, Oct 2008]
Uniprot Description
MNS1: May play a role in the control of meiotic division and germ cell differentiation through regulation of pairing and recombination during meiosis. Belongs to the MNS1 family.
Protein type: Cytoskeletal
Chromosomal Location of Human Ortholog: 15q21.3
Cellular Component: intermediate filament; nuclear envelope; axoneme
Molecular Function: identical protein binding
Biological Process: meiotic cell cycle
Research Articles on MNS1
Similar Products
Product Notes
The MNS1 mns1 (Catalog #AAA5300334) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MNS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the MNS1 mns1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MNS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
