Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FRS3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: DU145 cell lysate)

Rabbit FRS3 Polyclonal Antibody | anti-FRS3 antibody

FRS3 antibody - middle region

Gene Names
FRS3; SNT2; FRS2B; SNT-2; FRS2beta; FRS2-beta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FRS3; Polyclonal Antibody; FRS3 antibody - middle region; anti-FRS3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPG
Sequence Length
492
Applicable Applications for anti-FRS3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FRS3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FRS3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: DU145 cell lysate)

Western Blot (WB) (WB Suggested Anti-FRS3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: DU145 cell lysate)
Related Product Information for anti-FRS3 antibody
This is a rabbit polyclonal antibody against FRS3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FRS3 is an adapter protein that links FGR and NGF receptors to downstream signaling pathways. FRS3 is involved in the activation of MAP kinases. FRS3 down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2.The protein encoded by this gene is a substrate for the fibroblast growth factor receptor. It is found in peripheral plasma membrane and functions in linking FGF receptor stimulation to activators of Ras. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
fibroblast growth factor receptor substrate 3
NCBI Official Synonym Full Names
fibroblast growth factor receptor substrate 3
NCBI Official Symbol
FRS3
NCBI Official Synonym Symbols
SNT2; FRS2B; SNT-2; FRS2beta; FRS2-beta
NCBI Protein Information
fibroblast growth factor receptor substrate 3
UniProt Protein Name
Fibroblast growth factor receptor substrate 3
UniProt Gene Name
FRS3
UniProt Synonym Gene Names
FGFR substrate 3; SNT-2
UniProt Entry Name
FRS3_HUMAN

NCBI Description

This gene encodes a substrate for the fibroblast growth factor receptor. The encoded protein is found in the peripheral plasma membrane and links fibroblast growth factor receptor stimulation to activators of Ras. The encoded protein down-regulates extracellular regulated kinase 2 through direct binding. [provided by RefSeq, Jul 2013]

Uniprot Description

FRS3: Adapter protein that links FGF and NGF receptors to downstream signaling pathways. Involved in the activation of MAP kinases. Down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: plasma membrane

Molecular Function: protein binding; insulin receptor binding; fibroblast growth factor receptor binding

Biological Process: fibroblast growth factor receptor signaling pathway; signal transduction

Research Articles on FRS3

Similar Products

Product Notes

The FRS3 frs3 (Catalog #AAA3210677) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FRS3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FRS3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FRS3 frs3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFPDGEEDET PLQKPTSTRA AIRSHGSFPV PLTRRRGSPR VFNFDFRRPG. It is sometimes possible for the material contained within the vial of "FRS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.