Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FRS2Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human FRS2 Polyclonal Antibody | anti-FRS2 antibody

FRS2 Antibody - middle region

Gene Names
FRS2; SNT; SNT1; FRS1A; FRS2A; SNT-1; FRS2alpha
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FRS2; Polyclonal Antibody; FRS2 Antibody - middle region; anti-FRS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTST
Sequence Length
508
Applicable Applications for anti-FRS2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FRS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FRS2Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FRS2Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-FRS2 antibody
Adapter protein that links activated FGR and NGF receptors to downstream signaling pathways. Plays an important role in the activation of MAP kinases and in the phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, in response to ligand-mediated activation of FGFR1. Modulates signaling via SHC1 by competing for a common binding site on NTRK1.
Product Categories/Family for anti-FRS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
fibroblast growth factor receptor substrate 2
NCBI Official Synonym Full Names
fibroblast growth factor receptor substrate 2
NCBI Official Symbol
FRS2
NCBI Official Synonym Symbols
SNT; SNT1; FRS1A; FRS2A; SNT-1; FRS2alpha
NCBI Protein Information
fibroblast growth factor receptor substrate 2
UniProt Protein Name
Fibroblast growth factor receptor substrate 2
UniProt Gene Name
FRS2
UniProt Synonym Gene Names
FGFR substrate 2; SNT-1
UniProt Entry Name
FRS2_HUMAN

Uniprot Description

FRS2: an adaptor protein involved in fibroblast growth factor receptor (FGFR) signaling. Plays an important role in linking FGFR and nerve growth factor receptors with Ras/MAPK signaling pathways.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 12q15

Cellular Component: membrane; integral to plasma membrane; plasma membrane; intercellular junction; endosome

Molecular Function: protein binding; phosphatase activator activity; neurotrophin TRKA receptor binding; transmembrane receptor protein tyrosine kinase adaptor protein activity; insulin receptor binding; fibroblast growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; activation of MAPKK activity; activation of MAPK activity; gastrulation with mouth forming second; regulation of epithelial cell proliferation; regulation of apoptosis; G-protein coupled receptor protein signaling pathway; determination of anterior/posterior axis, embryo; induction of an organ; neuroblast proliferation; forebrain development; insulin receptor signaling pathway; innate immune response; optic placode formation involved in camera-type eye; transmembrane receptor protein tyrosine phosphatase signaling pathway

Research Articles on FRS2

Similar Products

Product Notes

The FRS2 frs2 (Catalog #AAA3223062) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FRS2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FRS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FRS2 frs2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ANNTEWDTGY DSDERRDAPS VNKLVYENIN GLSIPSASGV RRGRLTSTST. It is sometimes possible for the material contained within the vial of "FRS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.