Src kinase-associated phosphoprotein 1 Recombinant Protein | SKAP1 recombinant protein

Recombinant Human Src kinase-associated phosphoprotein 1

Cat. Num. AAA1375390

• Gene Names: SKAP1; SCAP1; SKAP55; HEL-S-81p
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Src kinase-associated phosphoprotein 1; Recombinant Human Src kinase-associated phosphoprotein 1; Src family-associated phosphoprotein 1; Src kinase-associated phosphoprotein of 55 kDa; SKAP-55; pp55; SKAP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-358aa; Full Length
• Sequence: MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEE
• Sequence Length: 358

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SKAP1 recombinant protein

Positively regulates T-cell receptor signaling by enhancing the MAP kinase pathway. Required for optimal conjugation between T-cells and antigen-presenting cells by promoting the clustering of integrin ITGAL on the surface of T-cells. May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells.

Product Categories/Family for SKAP1 recombinant protein

Immunology

References

Molecular cloning of SKAP55, a novel protein that associates with p59fyn in human T-lymphocytes.Marie-Cardine A., Bruyns E., Eckerskorn C., Kirchgessner H., Meuer S., Schraven B.J. Biol. Chem. 272:16077-16080(1997) DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 115527076
• NCBI GeneID: 8631
• NCBI Accession #: NP_001068567.1
• NCBI GenBank Nucleotide #: NM_001075099.1
• UniProt Accession #: Q86WV1; O15268; D3DTV1
• Molecular Weight: 57.3 kDa
• NCBI Official Full Name: src kinase-associated phosphoprotein 1 isoform 2
• NCBI Official Synonym Full Names: src kinase associated phosphoprotein 1
• NCBI Official Symbol: SKAP1
• NCBI Official Synonym Symbols: SCAP1; SKAP55; HEL-S-81p
• NCBI Protein Information: src kinase-associated phosphoprotein 1
• UniProt Protein Name: Src kinase-associated phosphoprotein 1
• Protein Family: Src kinase-associated phosphoprotein
• UniProt Gene Name: SKAP1
• UniProt Synonym Gene Names: SCAP1; SKAP55; SKAP-55; pp55
• UniProt Entry Name: SKAP1_HUMAN

NCBI Description

This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. [provided by RefSeq, Jul 2008]

Uniprot Description

SKAP55: Positively regulates T-cell receptor signaling by enhancing the MAP kinase pathway. Required for optimal conjugation between T-cells and antigen-presenting cells by promoting the clustering of integrin ITGAL on the surface of T-cells. May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells. Belongs to the SKAP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: cytoplasm; cytosol; intercellular junction; nucleus; plasma membrane; T cell receptor complex

Molecular Function: protein binding; protein complex binding; protein kinase binding; protein phosphatase binding; SH2 domain binding; SH3 domain binding; SH3/SH2 adaptor activity

Biological Process: adaptive immune response; positive regulation of cell adhesion; positive regulation of signal transduction; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; T cell receptor signaling pathway