Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FOXN1 Antibody Titration: 5.0ug/mlELISA Titer: 1:1562500Positive Control: Raji cell lysateFOXN1 is supported by BioGPS gene expression data to be expressed in Raji)

Rabbit FOXN1 Polyclonal Antibody | anti-FOXN1 antibody

FOXN1 antibody - N-terminal region

Gene Names
FOXN1; WHN; RONU; FKHL20
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
FOXN1; Polyclonal Antibody; FOXN1 antibody - N-terminal region; anti-FOXN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FVSDGPPERTPSLPPHSPRIASPGPEQVQGHCPAGPGPGPFRLSPSDKYP
Sequence Length
648
Applicable Applications for anti-FOXN1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FOXN1 Antibody Titration: 5.0ug/mlELISA Titer: 1:1562500Positive Control: Raji cell lysateFOXN1 is supported by BioGPS gene expression data to be expressed in Raji)

Western Blot (WB) (WB Suggested Anti-FOXN1 Antibody Titration: 5.0ug/mlELISA Titer: 1:1562500Positive Control: Raji cell lysateFOXN1 is supported by BioGPS gene expression data to be expressed in Raji)
Related Product Information for anti-FOXN1 antibody
This is a rabbit polyclonal antibody against FOXN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Mutations in the winged-helix transcription factor gene at the nude locus in mice and rats produce the pleiotropic phenotype of hairlessness and athymia, resulting in a severely compromised immune system. This gene is orthologous to the mouse and rat genes and encodes a similar DNA-binding transcription factor that is thought to regulate keratin gene expression. A mutation in this gene has been correlated with T-cell immunodeficiency, the skin disorder congenital alopecia, and nail dystrophy. Alternative splicing in the 5' UTR of this gene has been observed.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
forkhead box protein N1
NCBI Official Synonym Full Names
forkhead box N1
NCBI Official Symbol
FOXN1
NCBI Official Synonym Symbols
WHN; RONU; FKHL20
NCBI Protein Information
forkhead box protein N1
UniProt Protein Name
Forkhead box protein N1
Protein Family
UniProt Gene Name
FOXN1
UniProt Synonym Gene Names
RONU; WHN
UniProt Entry Name
FOXN1_HUMAN

NCBI Description

Mutations in the winged-helix transcription factor gene at the nude locus in mice and rats produce the pleiotropic phenotype of hairlessness and athymia, resulting in a severely compromised immune system. This gene is orthologous to the mouse and rat genes and encodes a similar DNA-binding transcription factor that is thought to regulate keratin gene expression. A mutation in this gene has been correlated with T-cell immunodeficiency, the skin disorder congenital alopecia, and nail dystrophy. Alternative splicing in the 5' UTR of this gene has been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXN1: Transcriptional regulator involved in development. Defects in FOXN1 are the cause of T-cell immunodeficiency congenital alopecia and nail dystrophy (TIDAND). A disorder characterized by the association of congenital alopecia, severe T-cell immunodeficiency, and ridging and pitting of all nails.

Protein type: Transcription factor; DNA-binding; Cell development/differentiation

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; keratinocyte differentiation; organ morphogenesis; epidermis development; epithelial cell proliferation; hair follicle development; thymus development; regulation of T cell differentiation in the thymus; defense response; lymphocyte homeostasis

Disease: T-cell Immunodeficiency, Congenital Alopecia, And Nail Dystrophy

Research Articles on FOXN1

Similar Products

Product Notes

The FOXN1 foxn1 (Catalog #AAA3200144) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXN1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FOXN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOXN1 foxn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FVSDGPPERT PSLPPHSPRI ASPGPEQVQG HCPAGPGPGP FRLSPSDKYP. It is sometimes possible for the material contained within the vial of "FOXN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.