Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FOXC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit FOXC1 Polyclonal Antibody | anti-FOXC1 antibody

FOXC1 antibody - C-terminal region

Gene Names
FOXC1; ARA; IGDA; IHG1; ASGD3; FKHL7; IRID1; RIEG3; FREAC3; FREAC-3
Reactivity
Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FOXC1; Polyclonal Antibody; FOXC1 antibody - C-terminal region; anti-FOXC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDC
Sequence Length
553
Applicable Applications for anti-FOXC1 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FOXC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FOXC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-FOXC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-FOXC1 antibody
This is a rabbit polyclonal antibody against FOXC1. It was validated on Western Blot

Target Description: FOXC1 belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
forkhead box protein C1
NCBI Official Synonym Full Names
forkhead box C1
NCBI Official Symbol
FOXC1
NCBI Official Synonym Symbols
ARA; IGDA; IHG1; ASGD3; FKHL7; IRID1; RIEG3; FREAC3; FREAC-3
NCBI Protein Information
forkhead box protein C1
UniProt Protein Name
Forkhead box protein C1
Protein Family
UniProt Gene Name
FOXC1
UniProt Synonym Gene Names
FKHL7; FREAC3; FREAC-3
UniProt Entry Name
FOXC1_HUMAN

NCBI Description

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXC1: Binding of FREAC-3 and FREAC-4 to their cognate sites results in bending of the DNA at an angle of 80-90 degrees. Monomer. Expressed in all tissues and cell lines examined.

Protein type: Transcription factor; Cell development/differentiation; DNA-binding; Cell cycle regulation

Chromosomal Location of Human Ortholog: 6p25

Cellular Component: nucleoplasm; cytoplasm; nuclear heterochromatin; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; DNA binding; sequence-specific DNA binding; transcription factor binding; DNA bending activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; collagen fibril organization; neural crest cell development; glycosaminoglycan metabolic process; paraxial mesoderm formation; positive regulation of transcription, DNA-dependent; heart development; cardiac muscle cell proliferation; ovarian follicle development; regulation of transcription, DNA-dependent; ureteric bud development; germ cell migration; ventricular cardiac muscle morphogenesis; negative regulation of mitotic cell cycle; lacrimal gland development; regulation of blood vessel size; skeletal development; mesenchymal cell development; ossification; somitogenesis; Notch signaling pathway; cell migration; camera-type eye development; in utero embryonic development; regulation of organ growth; odontogenesis of dentine-containing teeth; cell proliferation; eye development; artery morphogenesis; embryonic heart tube development; blood vessel remodeling; positive regulation of transcription from RNA polymerase II promoter; brain development; vascular endothelial growth factor receptor signaling pathway; lymph vessel development

Disease: Axenfeld-rieger Syndrome, Type 3; Iridogoniodysgenesis, Type 1

Research Articles on FOXC1

Similar Products

Product Notes

The FOXC1 foxc1 (Catalog #AAA3203866) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXC1 antibody - C-terminal region reacts with Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FOXC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOXC1 foxc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QQNFHSVREM FESQRIGLNN SPVNGNSSCQ MAFPSSQSLY RTSGAFVYDC. It is sometimes possible for the material contained within the vial of "FOXC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.