Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FMO9P expression in transfected 293T cell line by FMO9P polyclonal antibody. Lane 1: LOC116123 transfected lysate (17.6kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human FMO9P Polyclonal Antibody | anti-Fmo9 antibody

FMO9P (Flavin Containing Monooxygenase 9 Pseudogene, RP11-45J16.2)

Gene Names
Fmo9; Fmo9p
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FMO9P; Polyclonal Antibody; FMO9P (Flavin Containing Monooxygenase 9 Pseudogene; RP11-45J16.2); Anti -FMO9P (Flavin Containing Monooxygenase 9 Pseudogene; anti-Fmo9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FMO9P.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPSIYKSVTINTSKEMMCFSDFPVPDHFPNYMHNSKLMDYFGMYATHFGLLNYIRFKTEVQSVRKHPDFSINGQWDVVVETEEKQETLVFDGVLVCSGHHTDPYLPLQSFPGIEKFEGCYFHSREYKSPEDFSGKRIIVIGIGNSGVDIAVELSRVAKQI
Applicable Applications for anti-Fmo9 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human FMO9P, aa1-160 (AAH14341.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FMO9P expression in transfected 293T cell line by FMO9P polyclonal antibody. Lane 1: LOC116123 transfected lysate (17.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FMO9P expression in transfected 293T cell line by FMO9P polyclonal antibody. Lane 1: LOC116123 transfected lysate (17.6kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-Fmo9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
flavin containing monooxygenase 9
NCBI Official Synonym Full Names
flavin containing monooxygenase 9
NCBI Official Symbol
Fmo9
NCBI Official Synonym Symbols
Fmo9p
NCBI Protein Information
flavin containing monooxygenase 9; flavin containing monooxygenase 9 pseudogene

Similar Products

Product Notes

The Fmo9 (Catalog #AAA643101) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FMO9P (Flavin Containing Monooxygenase 9 Pseudogene, RP11-45J16.2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FMO9P can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the Fmo9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPSIYKSVTI NTSKEMMCFS DFPVPDHFPN YMHNSKLMDY FGMYATHFGL LNYIRFKTEV QSVRKHPDFS INGQWDVVVE TEEKQETLVF DGVLVCSGHH TDPYLPLQSF PGIEKFEGCY FHSREYKSPE DFSGKRIIVI GIGNSGVDIA VELSRVAKQI. It is sometimes possible for the material contained within the vial of "FMO9P, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.