Western Blot (WB)
(FLJ14213 antibody (MBS5300759) used at 2.5 ug/ml to detect target protein.)
Rabbit FLJ14213 Polyclonal Antibody | anti-FLJ14213 antibody
FLJ14213 antibody
Gene Names
PRR5L; PROTOR2
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
FLJ14213; Polyclonal Antibody; FLJ14213 antibody; Polyclonal FLJ14213; Anti-FLJ14213; FLJ-14213; MGC16218; Hypothetical Protein Flj14213; FLJ 14213; anti-FLJ14213 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
FLJ14213 antibody was raised against the N terminal of FLJ14213
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FLJ14213 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
139
Applicable Applications for anti-FLJ14213 antibody
Western Blot (WB)
Application Notes
WB: 2.5 ug/ml
Biological Significance
FLJ14213 may be part of the TORC2 complex which plays a critical role in AKT1 'Ser-473' phosphorylation, and may modulate the phosphorylation of PKCA and regulate actin cytoskeleton organization
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
FLJ14213 antibody was raised using the N terminal of FLJ14213 corresponding to a region with amino acids SAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(FLJ14213 antibody (MBS5300759) used at 2.5 ug/ml to detect target protein.)
Western Blot (WB)
(FLJ14213 antibody (MBS5300759) used at 2.5 ug/ml to detect target protein.)
Related Product Information for anti-FLJ14213 antibody
Rabbit polyclonal FLJ14213 antibody raised against the N terminal of FLJ14213
Product Categories/Family for anti-FLJ14213 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
40 kDa (MW of target protein)
NCBI Official Full Name
FLJ14213 protein
NCBI Official Synonym Full Names
proline rich 5 like
NCBI Official Symbol
PRR5L
NCBI Official Synonym Symbols
PROTOR2
NCBI Protein Information
proline-rich protein 5-like
UniProt Protein Name
Proline-rich protein 5-like
UniProt Gene Name
PRR5L
UniProt Synonym Gene Names
PROTOR2; Protor-2
UniProt Entry Name
PRR5L_HUMAN
Uniprot Description
PROTOR2: May be part of the TORC2 complex which plays a critical role in AKT1 'Ser-473' phosphorylation, and may modulate the phosphorylation of PKCA and regulate actin cytoskeleton organization. Belongs to the PROTOR family. May replace PROTOR1 in the target of rapamycin 2 complex (TORC2) comprised of FRAP1, LST8, PROTOR1, RICTOR and MAPKAP1. 3 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 11p13-p12
Cellular Component: mitochondrion; TORC2 complex
Molecular Function: ubiquitin protein ligase binding
Biological Process: positive regulation of phosphoinositide 3-kinase cascade; negative regulation of protein amino acid phosphorylation; positive regulation of protein amino acid phosphorylation; negative regulation of signal transduction
Research Articles on FLJ14213
Similar Products
Product Notes
The FLJ14213 prr5l (Catalog #AAA5300759) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FLJ14213 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's FLJ14213 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 2.5 ug/ml. Researchers should empirically determine the suitability of the FLJ14213 prr5l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FLJ14213, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
