Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (FLII antibody - middle region Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissuePrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Rabbit FLII Polyclonal Antibody | anti-FLII antibody

FLII antibody - middle region

Gene Names
FLII; FLI; FLIL; Fli1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
FLII; Polyclonal Antibody; FLII antibody - middle region; anti-FLII antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR
Sequence Length
1269
Applicable Applications for anti-FLII antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FLII
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(FLII antibody - middle region Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissuePrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (FLII antibody - middle region Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissuePrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-FLII Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)

Western Blot (WB) (WB Suggested Anti-FLII Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-FLII antibody
This is a rabbit polyclonal antibody against FLII. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.This gene encodes a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
145kDa
NCBI Official Full Name
protein flightless-1 homolog isoform 1
NCBI Official Synonym Full Names
FLII actin remodeling protein
NCBI Official Symbol
FLII
NCBI Official Synonym Symbols
FLI; FLIL; Fli1
NCBI Protein Information
protein flightless-1 homolog
UniProt Protein Name
Protein flightless-1 homolog
UniProt Gene Name
FLII
UniProt Synonym Gene Names
FLIL
UniProt Entry Name
FLII_HUMAN

NCBI Description

This gene encodes a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]

Uniprot Description

FLI: May play a role as coactivator in transcriptional activation by hormone-activated nuclear receptors (NR) and acts in cooperation with NCOA2 and CARM1. Involved in estrogen hormone signaling. Involved in early embryonic development. May play a role in regulation of cytoskeletal rearrangements involved in cytokinesis and cell migration. Deletion of the FLII gene may be a cause of Smith-Magenis syndrome (SMS). It is a contiguous gene deletion syndrome involving developmental abnormalities and mental retardation. The spectrum of clinical findings includes short stature, brachydactyly, developmental delay, dysmorphic features, sleep disturbances, and behavioral problems.

Protein type: Nuclear receptor co-regulator; Actin-binding

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: nucleoplasm; focal adhesion; cytoplasm; microtubule organizing center

Molecular Function: protein binding; actin binding

Biological Process: actin filament severing; muscle contraction; transcription, DNA-dependent; regulation of transcription, DNA-dependent; multicellular organismal development; actin cytoskeleton organization and biogenesis

Disease: Smith-magenis Syndrome

Research Articles on FLII

Similar Products

Product Notes

The FLII flii (Catalog #AAA3211764) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FLII antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FLII can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the FLII flii for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LAEDILNTMF DTSYSKQVIN EGEEPENFFW VGIGAQKPYD DDAEYMKHTR. It is sometimes possible for the material contained within the vial of "FLII, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.