Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-LSP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit LSP1 Polyclonal Antibody | anti-LSP1 antibody

LSP1 antibody - N-terminal region

Gene Names
LSP1; WP34; pp52
Reactivity
Dog, Guinea Pig, Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
LSP1; Polyclonal Antibody; LSP1 antibody - N-terminal region; anti-LSP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWS
Sequence Length
339
Applicable Applications for anti-LSP1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Dog: 83%; Guinea Pig: 90%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LSP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-LSP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-LSP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-LSP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)

Western Blot (WB) (WB Suggested Anti-LSP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-LSP1 antibody
This is a rabbit polyclonal antibody against LSP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This protein is an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration.This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-LSP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
lymphocyte-specific protein 1 isoform 1
NCBI Official Synonym Full Names
lymphocyte specific protein 1
NCBI Official Symbol
LSP1
NCBI Official Synonym Symbols
WP34; pp52
NCBI Protein Information
lymphocyte-specific protein 1
UniProt Protein Name
Lymphocyte-specific protein 1
UniProt Gene Name
LSP1
UniProt Synonym Gene Names
WP34; pp52
UniProt Entry Name
LSP1_HUMAN

NCBI Description

This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

LSP1: May play a role in mediating neutrophil activation and chemotaxis. Binds actin. Activated T-lymphocytes.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: membrane; plasma membrane; actin cytoskeleton

Molecular Function: signal transducer activity; actin binding

Biological Process: cellular defense response; chemotaxis; cell motility; signal transduction

Research Articles on LSP1

Similar Products

Product Notes

The LSP1 lsp1 (Catalog #AAA3224313) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LSP1 antibody - N-terminal region reacts with Dog, Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's LSP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the LSP1 lsp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CQHERDRQLQ AQDEEGGGHV PERPKQEMLL SLKPSEAPEL DEDEGFGDWS. It is sometimes possible for the material contained within the vial of "LSP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.