Rabbit ID2 Polyclonal Antibody | anti-ID2 antibody

ID2 antibody - middle region

Cat. Num. AAA3224680

• Gene Names: ID2; GIG8; ID2A; ID2H; bHLHb26
• Reactivity: Cow, Human, Mouse, Pig, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: ID2; Polyclonal Antibody; ID2 antibody - middle region; anti-ID2 antibody

• Host: Rabbit
• Reactivity: Cow, Human, Mouse, Pig, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC
• Sequence Length: 134

• Applicable Applications for anti-ID2 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ID2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-ID2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Rabbit Anti-ID2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Nucleus in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-ID2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)

Related Product Information for anti-ID2 antibody

This is a rabbit polyclonal antibody against ID2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ID2 belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation.The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Product Categories/Family for anti-ID2 antibody

Polyclonal; Drugs and Drug Metabolism; Cell Biology; Neuroscience; Various; DNA/RNA/Protein Interactions; Transcription Factors; Cell Differentiation

NCBI and Uniprot Product Information

• NCBI GI #: 31982933
• NCBI GeneID: 3398
• NCBI Accession #: NP_002157
• NCBI GenBank Nucleotide #: NM_002166
• UniProt Accession #: Q02363
• Molecular Weight: 15kDa
• NCBI Official Full Name: DNA-binding protein inhibitor ID-2
• NCBI Official Synonym Full Names: inhibitor of DNA binding 2
• NCBI Official Symbol: ID2
• NCBI Official Synonym Symbols: GIG8; ID2A; ID2H; bHLHb26
• NCBI Protein Information: DNA-binding protein inhibitor ID-2
• UniProt Protein Name: DNA-binding protein inhibitor ID-2
• Protein Family: DNA-binding protein inhibitor
• UniProt Gene Name: ID2
• UniProt Synonym Gene Names: BHLHB26; bHLHb26
• UniProt Entry Name: ID2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq, Aug 2011]

Uniprot Description

ID2: ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID-2 may be an inhibitor of tissue-specific gene expression. Heterodimer with other HLH proteins. Interacts with GATA4, IFI204 and NKX2-5. Interacts with NR0B2. Highly expressed in early fetal tissues, including those of the central nervous system.

Protein type: DNA-binding; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 2p25

Cellular Component: microtubule cytoskeleton; nucleoplasm; centrosome; protein complex; cytoplasm; nucleus; chromatin; cytosol

Molecular Function: protein dimerization activity; protein binding

Biological Process: regulation of lipid metabolic process; positive regulation of transcription, DNA-dependent; multicellular organismal development; positive regulation of smooth muscle cell proliferation; cell maturation; negative regulation of transcription from RNA polymerase II promoter; entrainment of circadian clock by photoperiod; locomotor rhythm; embryonic digestive tract morphogenesis; natural killer cell differentiation; negative regulation of osteoblast differentiation; circadian regulation of gene expression; positive regulation of macrophage differentiation; oligodendrocyte development; positive regulation of astrocyte differentiation; Peyer's patch development; negative regulation of B cell differentiation; transcription, DNA-dependent; negative regulation of transcription factor activity; positive regulation of erythrocyte differentiation; olfactory bulb development; neuron fate commitment; mammary gland epithelial cell proliferation; enucleate erythrocyte differentiation; regulation of circadian rhythm; negative regulation of DNA binding; negative regulation of oligodendrocyte differentiation; negative regulation of neuron differentiation; positive regulation of fat cell differentiation; negative regulation of transcription, DNA-dependent; metanephros development; positive regulation of blood pressure