Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human FKBP5 Polyclonal Antibody | anti-FKBP5 antibody

FKBP5 (FK506-binding Protein 5, Peptidyl-prolyl cis-trans Isomerase FKBP5, PPIase FKBP5, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 51kD FK506-binding Protein, 51kD FKBP, FKBP-51, 54kD Progesterone Receptor-associated Immunophilin, FKBP54, p

Gene Names
FKBP5; P54; AIG6; FKBP51; FKBP54; PPIase; Ptg-10
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FKBP5; Polyclonal Antibody; FKBP5 (FK506-binding Protein 5; Peptidyl-prolyl cis-trans Isomerase FKBP5; PPIase FKBP5; Rotamase; HSP-binding Immunophilin; HBI; FKBP52 Protein; 51kD FK506-binding Protein; 51kD FKBP; FKBP-51; 54kD Progesterone Receptor-associated Immunophilin; FKBP54; p; anti-FKBP5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FKBP5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
457
Applicable Applications for anti-FKBP5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FKBP5, aa1-457 (NP_004108.1).
Immunogen Sequence
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-FKBP5 antibody
The protein is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90kD heat shock protein and P23 protein.
Product Categories/Family for anti-FKBP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP5 isoform 1
NCBI Official Synonym Full Names
FKBP prolyl isomerase 5
NCBI Official Symbol
FKBP5
NCBI Official Synonym Symbols
P54; AIG6; FKBP51; FKBP54; PPIase; Ptg-10
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP5
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP5
Protein Family
UniProt Gene Name
FKBP5
UniProt Synonym Gene Names
AIG6; FKBP51; PPIase FKBP5; 51 kDa FKBP; FKBP-51; FKBP-5; p54
UniProt Entry Name
FKBP5_HUMAN

NCBI Description

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]

Uniprot Description

FKBP5: Interacts with functionally mature heterooligomeric progesterone receptor complexes along with HSP90 and TEBP. Part of a heteromultimeric cytoplasmic complex with HSP90, HSP70 and steroid receptors. Dissociates from the complex when NR3C1 binds glucocorticoid. By androgen. Widely expressed, enriched in testis compared to other tissues. Inhibited by FK506 but not cyclosporin.

Protein type: EC 5.2.1.8; Isomerase; Chaperone

Chromosomal Location of Human Ortholog: 6p21.31

Cellular Component: nucleoplasm; endoplasmic reticulum membrane; membrane

Molecular Function: protein binding; peptidyl-prolyl cis-trans isomerase activity; FK506 binding; heat shock protein binding

Biological Process: protein peptidyl-prolyl isomerization; protein folding

Disease: Major Depressive Disorder

Research Articles on FKBP5

Similar Products

Product Notes

The FKBP5 fkbp5 (Catalog #AAA6378677) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FKBP5 (FK506-binding Protein 5, Peptidyl-prolyl cis-trans Isomerase FKBP5, PPIase FKBP5, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 51kD FK506-binding Protein, 51kD FKBP, FKBP-51, 54kD Progesterone Receptor-associated Immunophilin, FKBP54, p reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FKBP5 fkbp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FKBP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.