Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FKBP1ASample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

Rabbit FKBP1A Polyclonal Antibody | anti-FKBP1A antibody

FKBP1A antibody - N-terminal region

Gene Names
FKBP1A; FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FKBP1A; Polyclonal Antibody; FKBP1A antibody - N-terminal region; anti-FKBP1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLG
Sequence Length
108
Applicable Applications for anti-FKBP1A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 90%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FKBP1ASample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FKBP1ASample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-FKBP1A AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Western Blot (WB) (WB Suggested Anti-FKBP1A AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Related Product Information for anti-FKBP1A antibody
This is a rabbit polyclonal antibody against FKBP1A. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium.
Product Categories/Family for anti-FKBP1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP1A isoform a
NCBI Official Synonym Full Names
FKBP prolyl isomerase 1A
NCBI Official Symbol
FKBP1A
NCBI Official Synonym Symbols
FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP1A
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP1A
UniProt Gene Name
FKBP1A
UniProt Synonym Gene Names
FKBP1; FKBP12; PPIase FKBP1A; 12 kDa FKBP; FKBP-12; FKBP-1A
UniProt Entry Name
FKB1A_HUMAN

NCBI Description

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq, Sep 2008]

Uniprot Description

FKBP12: an immunophilin and peptidyl-prolyl cis-trans isomerase that binds to the immunosuppressant drugs FK506 (a.k.a. tacrolimus or Fujimycin) and rapamycin (a.k.a. Sirolimus). The FKBP12/rapamycin complex binds NFAT transcription factors and inhibits the induction of T cell genes including IL-2, IL-3, IL-4, TNF-alpha and GM-CSF. FK506 is used in treating patients after organ transplant and those suffering from autoimmune disorders. The immunosuppressant activity of FKBP12 is not apparently related to its prolyl isomerase activity. The FKBP12/rapamycin complex inhibits the mammalian target of rapamycin (mTOR) pathway by directly binding the mTOR Complex1 (mTORC1). mTORC1 contains Raptor, mLST8, and PRAS40, and interacts with DEPTOR, which inhibits its activity. mTOR, a S/T protein kinase, is a central regulator of cellular growth and metabolism. Its inhibition enhances the dependence on aerobic glycolysis in leukemic cells.

Protein type: EC 5.2.1.8; Isomerase

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; membrane; cytoplasm; nerve terminal; Z disc; cytosol

Molecular Function: signal transducer activity; protein binding; FK506 binding; enzyme binding; protein homodimerization activity; peptidyl-prolyl cis-trans isomerase activity; activin binding; macrolide binding; calcium channel inhibitor activity; Hsp70 protein binding; SMAD binding; transforming growth factor beta receptor binding

Biological Process: heart morphogenesis; protein maturation via protein folding; protein peptidyl-prolyl isomerization; protein folding; positive regulation of protein binding; T cell activation; response to caffeine; T cell proliferation; regulation of protein localization; negative regulation of protein amino acid phosphorylation; muscle contraction; transforming growth factor beta receptor signaling pathway; negative regulation of release of sequestered calcium ion into cytosol; fibril organization and biogenesis; ventricular cardiac muscle morphogenesis; protein refolding; response to iron ion; regulation of immune response; positive regulation of I-kappaB kinase/NF-kappaB cascade; cytokine and chemokine mediated signaling pathway; regulation of activin receptor signaling pathway; SMAD protein complex assembly; negative regulation of protein phosphatase type 2B activity; 'de novo' protein folding; positive regulation of protein ubiquitination; release of sequestered calcium ion into cytosol

Research Articles on FKBP1A

Similar Products

Product Notes

The FKBP1A fkbp1a (Catalog #AAA3216678) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FKBP1A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FKBP1A fkbp1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VQVETISPGD GRTFPKRGQT CVVHYTGMLE DGKKFDSSRD RNKPFKFMLG. It is sometimes possible for the material contained within the vial of "FKBP1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.