Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FKBP11 expression in transfected 293T cell line by FKBP11 polyclonal antibody. Lane 1: FKBP11 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human FKBP11 Polyclonal Antibody | anti-FKBP11 antibody

FKBP11 (FK506-binding Protein 11, Peptidyl-prolyl Cis-trans Isomerase FKBP11, PPIase FKBP11, Rotamase, 19kD FK506-binding Protein, 19kD FKBP, FKBP-19, UNQ336/PRO535, FKBP19, FKBP-11, MGC54182) (HRP)

Gene Names
FKBP11; FKBP19
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FKBP11; Polyclonal Antibody; FKBP11 (FK506-binding Protein 11; Peptidyl-prolyl Cis-trans Isomerase FKBP11; PPIase FKBP11; Rotamase; 19kD FK506-binding Protein; 19kD FKBP; FKBP-19; UNQ336/PRO535; FKBP19; FKBP-11; MGC54182) (HRP); anti-FKBP11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FKBP11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-FKBP11 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FKBP11, aa1-201 (NP_057678.1).
Immunogen Sequence
MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FKBP11 expression in transfected 293T cell line by FKBP11 polyclonal antibody. Lane 1: FKBP11 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FKBP11 expression in transfected 293T cell line by FKBP11 polyclonal antibody. Lane 1: FKBP11 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FKBP11 antibody
FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin.
Product Categories/Family for anti-FKBP11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,769 Da
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP11 isoform 1
NCBI Official Synonym Full Names
FK506 binding protein 11, 19 kDa
NCBI Official Symbol
FKBP11
NCBI Official Synonym Symbols
FKBP19
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP11; FKBP-11; FKBP-19; rotamase; 19 kDa FKBP; PPIase FKBP11; FK506-binding protein 11; 19 kDa FK506-binding protein
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP11
UniProt Gene Name
FKBP11
UniProt Synonym Gene Names
FKBP19; PPIase FKBP11; 19 kDa FKBP; FKBP-19; FKBP-11
UniProt Entry Name
FKB11_HUMAN

NCBI Description

FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin (Rulten et al., 2006 [PubMed 16596453]).[supplied by OMIM, Mar 2008]

Uniprot Description

FKBP11: PPIases accelerate the folding of proteins during protein synthesis. Belongs to the FKBP-type PPIase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Isomerase; EC 5.2.1.8

Chromosomal Location of Human Ortholog: 12q13.12

Cellular Component: endoplasmic reticulum membrane; membrane; integral to membrane

Molecular Function: peptidyl-prolyl cis-trans isomerase activity; FK506 binding

Biological Process: protein peptidyl-prolyl isomerization

Research Articles on FKBP11

Similar Products

Product Notes

The FKBP11 fkbp11 (Catalog #AAA6378640) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FKBP11 (FK506-binding Protein 11, Peptidyl-prolyl Cis-trans Isomerase FKBP11, PPIase FKBP11, Rotamase, 19kD FK506-binding Protein, 19kD FKBP, FKBP-19, UNQ336/PRO535, FKBP19, FKBP-11, MGC54182) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FKBP11 fkbp11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FKBP11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.