Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using FICD antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 30s.)
Rabbit FICD Polyclonal Antibody | anti-FICD antibody
FICD Polyclonal Antibody
Gene Names
FICD; HYPE; HIP13; UNQ3041
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
FICD; Polyclonal Antibody; FICD Polyclonal Antibody; HIP13; HYPE; UNQ3041; anti-FICD antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
QGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTS
Sequence Length
458
Applicable Applications for anti-FICD antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human FICD
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Single-pass membrane protein
Positive Samples
293T, A-549, Jurkat, HeLa, Mouse lung, Rat ovary
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using FICD antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using FICD antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 30s.)
Product Categories/Family for anti-FICD antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 51kDa
Observed: 45kDa
Observed: 45kDa
NCBI Official Full Name
adenosine monophosphate-protein transferase FICD
NCBI Official Synonym Full Names
FIC domain containing
NCBI Official Symbol
FICD
NCBI Official Synonym Symbols
HYPE; HIP13; UNQ3041
NCBI Protein Information
adenosine monophosphate-protein transferase FICD
UniProt Protein Name
Adenosine monophosphate-protein transferase FICD
Protein Family
UniProt Gene Name
FICD
UniProt Synonym Gene Names
HIP13; HYPE; HIP-13
Uniprot Description
Adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. Able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified.
Research Articles on FICD
1. The single catalytic domain of FICD can release the attached AMP, restoring functionality to BiP.
Similar Products
Product Notes
The FICD ficd (Catalog #AAA9133779) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FICD Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FICD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the FICD ficd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QGKREKAQKL FMHALKMDPD FVDALTEFGI FSEEDKDIIQ ADYLYTRALT ISPYHEKALV NRDRTLPLVE EIDQRYFSII DSKVKKVMSI PKGNSALRRV MEETYYHHIY HTVAIEGNTL TLSEIRHILE TRYAVPGKSL EEQNEVIGMH AAMKYINTTL VSRIGSVTIS DVLEIHRRVL GYVDPVEAGR FRTTQVLVGH HIPPHPQDVE KQMQEFVQWL NSEEAMNLHP VEFAALAHYK LVYIHPFIDG NGRTS. It is sometimes possible for the material contained within the vial of "FICD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
