<
Immunohistochemistry (IHC)
(Human Pancreas)
Rabbit FEZF1 Polyclonal Antibody | anti-FEZF1 antibody
FEZF1 antibody - C-terminal region
Gene Names
FEZF1; FEZ; HH22; ZNF312B
Reactivity
Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
FEZF1; Polyclonal Antibody; FEZF1 antibody - C-terminal region; anti-FEZF1 antibody
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPM
Sequence Length
471
Applicable Applications for anti-FEZF1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Guinea Pig: 79%; Horse: 79%; Human: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FEZF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Pancreas)
Immunohistochemistry (IHC)
(Human Pancreas)
Immunohistochemistry (IHC)
(Human Pancreas)
Immunohistochemistry (IHC)
(Human Pancreas)
Immunohistochemistry (IHC)
(Human Placenta)
Immunohistochemistry (IHC)
(Human Placenta)
Western Blot (WB)
(Host: RabbitTarget Name: FEZF1Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: FEZF1Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-FEZF1 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-FEZF1 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)
Related Product Information for anti-FEZF1 antibody
This is a rabbit polyclonal antibody against FEZF1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: FEZF1 is a transcription repressor. It is involved in the axonal projection and proper termination of olfactory sensory neurons (OSN). It plays a role in rostro-caudal patterning of the diencephalon and in prethalamic formation. Expression of the FEZF1 is required in OSN to cell-autonomously regulate OSN axon projections. FEZF1 regulates non-cell-autonomously the layer formation of the olfactory bulb development and the interneurons. It may be required for correct rostral migration of the interneuron progenitors.
Target Description: FEZF1 is a transcription repressor. It is involved in the axonal projection and proper termination of olfactory sensory neurons (OSN). It plays a role in rostro-caudal patterning of the diencephalon and in prethalamic formation. Expression of the FEZF1 is required in OSN to cell-autonomously regulate OSN axon projections. FEZF1 regulates non-cell-autonomously the layer formation of the olfactory bulb development and the interneurons. It may be required for correct rostral migration of the interneuron progenitors.
Product Categories/Family for anti-FEZF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
fez family zinc finger protein 1 isoform 1
NCBI Official Synonym Full Names
FEZ family zinc finger 1
NCBI Official Symbol
FEZF1
NCBI Official Synonym Symbols
FEZ; HH22; ZNF312B
NCBI Protein Information
fez family zinc finger protein 1
UniProt Protein Name
Fez family zinc finger protein 1
Protein Family
UniProt Gene Name
FEZF1
UniProt Synonym Gene Names
FEZ; ZNF312B
UniProt Entry Name
FEZF1_HUMAN
NCBI Description
This gene encodes a transcriptional repressor that belongs to the zinc finger double domain protein family. The encoded protein is thought to play a role in the embryonic migration of gonadotropin-releasing hormone neurons into the brain. Mutations in this gene are associated with hypogonadotropic hypogonadism-22 with anosmia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
Research Articles on FEZF1
Similar Products
Product Notes
The FEZF1 fezf1 (Catalog #AAA3209921) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FEZF1 antibody - C-terminal region reacts with Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FEZF1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the FEZF1 fezf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPTCGKGFCR NFDLKKHVRK LHDSSLGLAR TPAGEPGTEP PPPLPQQPPM. It is sometimes possible for the material contained within the vial of "FEZF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
