Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FES AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Muscle)

Rabbit FES Polyclonal Antibody | anti-FES antibody

FES antibody - N-terminal region

Gene Names
FES; FPS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FES; Polyclonal Antibody; FES antibody - N-terminal region; anti-FES antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPISQTHSQDI
Sequence Length
764
Applicable Applications for anti-FES antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FES AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Muscle)

Western Blot (WB) (WB Suggested Anti-FES AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Muscle)
Related Product Information for anti-FES antibody
This is a rabbit polyclonal antibody against FES. It was validated on Western Blot

Target Description: FES is the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. FES has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic leukemia but it is also involved in normal hematopoiesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
tyrosine-protein kinase Fes/Fps isoform 2
NCBI Official Synonym Full Names
FES proto-oncogene, tyrosine kinase
NCBI Official Symbol
FES
NCBI Official Synonym Symbols
FPS
NCBI Protein Information
tyrosine-protein kinase Fes/Fps
UniProt Protein Name
Tyrosine-protein kinase Fes/Fps
UniProt Gene Name
FES
UniProt Synonym Gene Names
FPS
UniProt Entry Name
FES_HUMAN

NCBI Description

This gene encodes the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. The gene product has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic leukemia but it is also involved in normal hematopoiesis as well as growth factor and cytokine receptor signaling. Alternative splicing results in multiple variants encoding different isoforms.[provided by RefSeq, Jan 2009]

Uniprot Description

Fes: a non-receptor tyrosine kinase of the Fer family. Appears to be involved in normal hematopoiesis as well as the development of acute promyelocytic leukemia. Contains one SH2 and one FCH domain. Four LOF point mutations seen in colorectal cancer. Orthologous to v-fes from feline leukemia virus and v-fps from avian transforming virus. Mutant forms are angiogenic. Promotes survival during differentiation, and may act both to promote and inhibit tumors. May be disrupted in the t(15q+;17q-) found in acute promyelocytic leukemia, but the breakpoint does not occur within the gene.

Protein type: Oncoprotein; EC 2.7.10.2; Kinase, protein; Protein kinase, tyrosine (non-receptor); Protein kinase, TK; Tumor suppressor; TK group; Fer family

Chromosomal Location of Human Ortholog: 15q26.1

Cellular Component: microtubule cytoskeleton; Golgi apparatus; extrinsic to internal side of plasma membrane; focal adhesion; cytoplasm; cytoplasmic membrane-bound vesicle; cytoplasmic vesicle; cytosol

Molecular Function: protein binding; protein-tyrosine kinase activity; non-membrane spanning protein tyrosine kinase activity; phosphoinositide binding; ATP binding

Biological Process: regulation of cell adhesion; epidermal growth factor receptor signaling pathway; regulation of mast cell degranulation; axon guidance; cell migration; peptidyl-tyrosine phosphorylation; positive regulation of myeloid cell differentiation; multicellular organismal development; protein amino acid autophosphorylation; positive regulation of microtubule polymerization; chemotaxis; protein amino acid phosphorylation; regulation of cell proliferation; cell proliferation; regulation of cell shape; regulation of cell differentiation; innate immune response

Research Articles on FES

Similar Products

Product Notes

The FES fes (Catalog #AAA3211760) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FES antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FES can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FES fes for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGMRKWMAQR VKSDREYAGL LHHMSLQDSG GQSRAISPDS PISQTHSQDI. It is sometimes possible for the material contained within the vial of "FES, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.