Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FERMT2Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/mlFERMT2 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

Rabbit FERMT2 Polyclonal Antibody | anti-FERMT2 antibody

FERMT2 Antibody - C-terminal region

Gene Names
FERMT2; MIG2; KIND2; mig-2; UNC112; PLEKHC1; UNC112B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FERMT2; Polyclonal Antibody; FERMT2 Antibody - C-terminal region; anti-FERMT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGM
Sequence Length
687
Applicable Applications for anti-FERMT2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FERMT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FERMT2Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/mlFERMT2 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

Western Blot (WB) (Host: RabbitTarget Name: FERMT2Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/mlFERMT2 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)
Related Product Information for anti-FERMT2 antibody
This is a rabbit polyclonal antibody against FERMT2. It was validated on Western Blot

Target Description: FERMT2 participates in the connection between ECM adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. It recruits migfilin (FBLP1) protein to cell-ECM focal adhesion sites.
Product Categories/Family for anti-FERMT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
fermitin family homolog 2 isoform 1
NCBI Official Synonym Full Names
fermitin family member 2
NCBI Official Symbol
FERMT2
NCBI Official Synonym Symbols
MIG2; KIND2; mig-2; UNC112; PLEKHC1; UNC112B
NCBI Protein Information
fermitin family homolog 2
UniProt Protein Name
Fermitin family homolog 2
Protein Family
UniProt Gene Name
FERMT2
UniProt Synonym Gene Names
KIND2; MIG2; PLEKHC1; MIG-2; PH domain-containing family C member 1

Uniprot Description

Scaffolding protein that enhances integrin activation mediated by TLN1 and/or TLN2, but activates integrins only weakly by itself. Binds to membranes enriched in phosphoinositides. Enhances integrin-mediated cell adhesion onto the extracellular matrix and cell spreading; this requires both its ability to interact with integrins and with phospholipid membranes. Required for the assembly of focal adhesions. Participates in the connection between extracellular matrix adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. Recruits FBLIM1 to focal adhesions. Plays a role in the TGFB1 and integrin signaling pathways. Stabilizes active CTNNB1 and plays a role in the regulation of transcription mediated by CTNNB1 and TCF7L2/TCF4 and in Wnt signaling.

Research Articles on FERMT2

Similar Products

Product Notes

The FERMT2 fermt2 (Catalog #AAA3217812) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FERMT2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FERMT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FERMT2 fermt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TSISCYKSKE ESSGTPAHQM NLRGCEVTPD VNISGQKFNI KLLIPVAEGM. It is sometimes possible for the material contained within the vial of "FERMT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.