Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- FE65 Picoband antibody, MBS178207, Western blottingAll lanes: Anti FE65 (MBS178207) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: U87 Whole Cell Lysate at 40ugPredicted bind size: 65KDObserved bind size: 65KD)

FE65 Polyclonal Antibody | anti-FE65 antibody

Anti-FE65 Antibody

Gene Names
APBB1; RIR; FE65; MGC:9072
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
FE65; Polyclonal Antibody; Anti-FE65 Antibody; Amyloid beta A4 precursor protein-binding family B member 1; Adaptor protein FE65a2; Amyloid beta (A4) precursor protein binding family B member 1; Amyloid Beta A4 Precursor Protein Binding Family B; Amyloid beta A4 precursor protein binding family B member 1; Amyloid beta precursor protein binding family B member 1; APBB 1; APBB1; APBB1_HUMAN; FE 65; Fe65 protein; Protein Fe65; RIR; stat like protein; amyloid beta (A4) precursor protein-binding; family B; member 1 (Fe65); anti-FE65 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
710
Applicable Applications for anti-FE65 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human FE65 (21-56aa ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- FE65 Picoband antibody, MBS178207, Western blottingAll lanes: Anti FE65 (MBS178207) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: U87 Whole Cell Lysate at 40ugPredicted bind size: 65KDObserved bind size: 65KD)

Western Blot (WB) (Anti- FE65 Picoband antibody, MBS178207, Western blottingAll lanes: Anti FE65 (MBS178207) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: U87 Whole Cell Lysate at 40ugPredicted bind size: 65KDObserved bind size: 65KD)

Immunohistochemistry (IHC)

(Anti- FE65 Picoband antibody, MBS178207, IHC(P)IHC(P): Mouse Brain Tissue )

Immunohistochemistry (IHC) (Anti- FE65 Picoband antibody, MBS178207, IHC(P)IHC(P): Mouse Brain Tissue )

Immunohistochemistry (IHC)

(Anti- FE65 Picoband antibody, MBS178207, IHC(P)IHC(P): Rat Brain Tissue )

Immunohistochemistry (IHC) (Anti- FE65 Picoband antibody, MBS178207, IHC(P)IHC(P): Rat Brain Tissue )

Immunohistochemistry (IHC)

(Anti- FE65 Picoband antibody, MBS178207, IHC(P)IHC(P): Human Glioma Tissue )

Immunohistochemistry (IHC) (Anti- FE65 Picoband antibody, MBS178207, IHC(P)IHC(P): Human Glioma Tissue )
Related Product Information for anti-FE65 antibody
Description: Rabbit IgG polyclonal antibody for Amyloid beta A4 precursor protein-binding family B member 1(APBB1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: APBB1 is also known as RIR or FE65. The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimer's disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene product's nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimer's disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
References
1. Chen GB, et al. Association of amyloid precursor protein-binding protein, family B, member 1 with nicotine dependence in African and European American smokers. Hum Genet, 2008 Nov. 2. Cheung HN, et al. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FASEB J, 2014 Jan. 3. Ward MW, et al. The amyloid precursor protein intracellular domain (AICD) disrupts actin dynamics and mitochondrial bioenergetics. J Neurochem, 2010 Apr. 

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
322
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,656 Da
NCBI Official Full Name
amyloid beta A4 protein-binding family B member 1 isoform a
NCBI Official Synonym Full Names
amyloid beta precursor protein binding family B member 1
NCBI Official Symbol
APBB1
NCBI Official Synonym Symbols
RIR; FE65; MGC:9072
NCBI Protein Information
amyloid beta A4 precursor protein-binding family B member 1
UniProt Protein Name
Amyloid beta A4 precursor protein-binding family B member 1
UniProt Gene Name
APBB1
UniProt Synonym Gene Names
FE65; RIR
UniProt Entry Name
APBB1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimer's disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene product's nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimer's disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

Fe65: adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain. Plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis. May act by specifically recognizing and binding histone H2AX phosphorylated on Y142 (H2AXpY142) at double-strand breaks (DSBs), recruiting other pro-apoptosis factors such as JNK1. Required for histone H4 acetylation at double-strand breaks (DSBs). Its ability to specifically bind modified histones and chromatin modifying enzymes such as TIP60, probably explains its trancription activation activity.

Protein type: Transcription regulation; Apoptosis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 11p15

Cellular Component: cell soma; cytoplasm; dendritic spine; growth cone; lamellipodium; nuclear speck; nucleoplasm; nucleus; perinuclear region of cytoplasm; plasma membrane; postsynaptic membrane; presynaptic membrane; protein complex; synapse

Molecular Function: beta-amyloid binding; chromatin binding; histone binding; protein binding; protein complex binding; tau protein binding; transcription factor binding

Biological Process: apoptosis; axonogenesis; cell cycle arrest; double-strand break repair; negative regulation of cell growth; negative regulation of thymidylate synthase biosynthetic process; positive regulation of apoptosis; positive regulation of DNA repair; positive regulation of protein secretion; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of transcription, DNA-dependent; response to DNA damage stimulus; response to iron ion; signal transduction; transcription, DNA-dependent

Research Articles on FE65

Similar Products

Product Notes

The FE65 apbb1 (Catalog #AAA178207) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-FE65 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FE65 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the FE65 apbb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FE65, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.