Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MUSK monoclonal antibody (M03), clone 4C12 Western Blot analysis of MUSK expression in Jurkat.)

Mouse MUSK Monoclonal Antibody | anti-MUSK antibody

MUSK (Muscle, Skeletal, Receptor Tyrosine Kinase, MGC126323, MGC126324) (Biotin)

Gene Names
MUSK; CMS9; FADS; FADS1
Applications
Western Blot
Purity
Purified
Synonyms
MUSK; Monoclonal Antibody; MUSK (Muscle; Skeletal; Receptor Tyrosine Kinase; MGC126323; MGC126324) (Biotin); Muscle; MGC126324; anti-MUSK antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C12
Specificity
Recognizes MUSK.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
869
Applicable Applications for anti-MUSK antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MUSK (NP_005583, 301aa-400aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MUSK monoclonal antibody (M03), clone 4C12 Western Blot analysis of MUSK expression in Jurkat.)

Western Blot (WB) (MUSK monoclonal antibody (M03), clone 4C12 Western Blot analysis of MUSK expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged MUSK is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MUSK is 1 ng/ml as a capture antibody.)
Related Product Information for anti-MUSK antibody
Intercellular communication is often mediated by receptors on the surface of one cell that recognize and are activated by specific protein ligands released by other cells. Members of one class of cell surface receptors, receptor tyrosine kinases (RTKs), are characterized by having a cytoplasmic domain containing intrinsic tyrosine kinase activity. This kinase activity is regulated by the binding of a cognate ligand to the extracellular portion of the receptor. DeChiara et al. (1996) [PubMed 8653786] noted that the RTKs, known to be expressed in cell type-specific fashions, play a role critical for the growth and differentiation of those cell types. For example, members of the neural-specific TRK family that recognize nerve growth factor are absolutely required for the survival and development of discrete neuronal subpopulations, and the receptor tyrosine kinases TIE1 (MIM 600222) and TIE2 (MIM 600221) play a critical role in the development of normal blood vessels. [supplied by OMIM]
Product Categories/Family for anti-MUSK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
muscle, skeletal receptor tyrosine-protein kinase isoform 1
NCBI Official Synonym Full Names
muscle associated receptor tyrosine kinase
NCBI Official Symbol
MUSK
NCBI Official Synonym Symbols
CMS9; FADS; FADS1
NCBI Protein Information
muscle, skeletal receptor tyrosine-protein kinase
UniProt Protein Name
Muscle, skeletal receptor tyrosine-protein kinase
Protein Family
UniProt Gene Name
MUSK
UniProt Synonym Gene Names
MuSK
UniProt Entry Name
MUSK_HUMAN

NCBI Description

This gene encodes a muscle-specific tyrosine kinase receptor. The encoded protein may play a role in clustering of the acetylcholine receptor in the postsynaptic neuromuscular junction. Mutations in this gene have been associated with congenital myasthenic syndrome. Alternatively spliced transcript variants have been described.[provided by RefSeq, Oct 2009]

Uniprot Description

MUSK: a receptor tyrosine kinase that is essential for the establishment and maintenance of the neuromuscular junction (NMJ). Its activation by agrin, a neuronally derived heparan-sulfate proteoglycan, and the agrin receptor (LRP4), leads to clustering of acetylcholine receptors on the postsynaptic side of the NMJ. Its activation by agrin requires Dok7, which interacts with the cytoplasmic portion of MuSK and activates its tyrosine kinase activity.

Protein type: EC 2.7.10.1; Protein kinase, tyrosine (receptor); Protein kinase, TK; Kinase, protein; Membrane protein, integral; TK group; Musk family

Chromosomal Location of Human Ortholog: 9q31.3-q32

Cellular Component: postsynaptic membrane; integral to plasma membrane; cell junction; neuromuscular junction; receptor complex

Molecular Function: protein binding; protein-tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: extracellular matrix organization and biogenesis; peptidyl-tyrosine phosphorylation; regulation of transcription, DNA-dependent; protein amino acid autophosphorylation; positive regulation of neuron apoptosis; multicellular organismal development; regulation of synaptic growth at neuromuscular junction; positive regulation of protein amino acid phosphorylation; cell differentiation; memory; neuromuscular junction development; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Myasthenic Syndrome, Congenital, 9, Associated With Acetylcholine Receptor Deficiency; Fetal Akinesia Deformation Sequence

Research Articles on MUSK

Similar Products

Product Notes

The MUSK musk (Catalog #AAA6171509) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MUSK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MUSK musk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MUSK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.