Rabbit anti-Human FBP2 Polyclonal Antibody | anti-FBP2 antibody

FBP2 (Fructose-1,6-bisphosphatase isozyme 2, FBPase 2, D-fructose-1,6-bisphosphate 1-phosphohydrolase 2, MGC142192) (Biotin)

Cat. Num. AAA6378209

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FBP2; Polyclonal Antibody; FBP2 (Fructose-1; 6-bisphosphatase isozyme 2; FBPase 2; D-fructose-1; 6-bisphosphate 1-phosphohydrolase 2; MGC142192) (Biotin); anti-FBP2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human FBP2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-FBP2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human FBP2, aa1-339 (NP_003828.2).
• Immunogen Sequence: MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FBP2 rabbit polyclonal antibody. Western Blot analysis of FBP2 expression in human colon.)

Western Blot (WB)

(Western Blot analysis of FBP2 expression in transfected 293T cell line by FBP2 polyclonal antibody. Lane 1: FBP2 transfected lysate (36.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-FBP2 antibody

FBP2 is a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate.

Product Categories/Family for anti-FBP2 antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 22907028
• NCBI GeneID: 8789
• NCBI Accession #: NP_003828.2
• NCBI GenBank Nucleotide #: NM_003837.2
• UniProt Accession #: O00757; Q17R39; Q6FI53
• Molecular Weight: 36,743 Da
• NCBI Official Full Name: fructose-1,6-bisphosphatase isozyme 2
• NCBI Official Synonym Full Names: fructose-1,6-bisphosphatase 2
• NCBI Official Symbol: FBP2
• NCBI Protein Information: fructose-1,6-bisphosphatase isozyme 2; D-fructose-1,6-bisphosphate 1-phosphohydrolase 2; FBPase 2; hexosediphosphatase; muscle FBPase; muscle fructose-bisphosphatase
• UniProt Protein Name: Fructose-1,6-bisphosphatase isozyme 2
• Protein Family: Fat body protein
• UniProt Gene Name: FBP2
• UniProt Synonym Gene Names: FBPase 2
• UniProt Entry Name: F16P2_HUMAN

NCBI Description

This gene encodes a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. [provided by RefSeq, Jul 2008]

Uniprot Description

FBPase 2: a key enzyme of gluconeogenesis that catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate, a precursor to glucose 6-phosphate. A regulator of glucose synthesis from non-carbohydrates. Two paralogs of this enzyme exists in humans: FBP1 is expressed in the liver and gluconeogenic tissues, and FBP2 in striated muscle. FBP2 is only isozyme expressed in striated muscle and it is widely expressed in cells that are nongluconeogenic. Both forms are inhibited allosterically by AMP, NAD and Ca2+. The muscle form is about 100-fold more sensitive to AMP and NAD, and about 1000-fold more sensitive to inhibition by Ca2+, the major activator of glycolysis in striated muscle. Forms an active complex with aldolase that binds to the sarcomeric Z-line, which is disrupted by elevated calcium levels, blocking glycogen synthesis during exercise. Forms homotetramers that are stabilized in the active state by divalent cations (Mg2+, Mn2+ , Co+2, or Zn2+). Its interaction with aldolase appears to desensitizes it to inhibition by AMP and, partially, by Ca2+. Up to 50% of lactate generated in striated muscle is converted to glycogen.

Protein type: Carbohydrate Metabolism - fructose and mannose; Carbohydrate Metabolism - pentose phosphate pathway; Carbohydrate Metabolism - glycolysis and gluconeogenesis; EC 3.1.3.11; Phosphatase (non-protein)

Chromosomal Location of Human Ortholog: 9q22.3

Cellular Component: Z disc; nucleus; cell junction; cytosol

Molecular Function: metal ion binding; fructose-bisphosphatase activity

Biological Process: dephosphorylation; carbohydrate metabolic process; glucose metabolic process; pathogenesis; fructose metabolic process; gluconeogenesis