Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Fascin Picoband antibody, MBS177840, Western blottingAll lanes: Anti Fascin (MBS177840) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: SKOV Whole Cell Lysate at 40ugPredicted bind size: 55KDObserved bind size: 55KD)

anti-Human, Rat Fascin Polyclonal Antibody | anti-FSCN1 antibody

Anti-Fascin Antibody

Gene Names
FSCN1; HSN; SNL; p55; FAN1
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Fascin; Polyclonal Antibody; Anti-Fascin Antibody; 55 kDa actin bundling protein; 55 kDa actin-bundling protein; Actin bundling protein; actin bundling protein; 55-KD; FAN 1; FAN1; Fascin 1; Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus); Fascin homolog 1; sea urchin; homolog of; 1; Fascin1; FLJ38511; FSCN 1; FSCN1; FSCN1_HUMAN; HSN; p55; Singed (Drosophila) like (sea urchin fascin homolog like); Singed drosophila homolog like; Singed like (fascin homolog sea urchin) (Drosophila); Singed like (fascin homolog sea urchin); Singed like protein; Singed; drosophila; Singed-like protein; SNL; Strongylocentrotus purpuratus; fascin homolog 1; actin-bundling protein (Strongylocentrotus purpuratus); anti-FSCN1 antibody
Ordering
For Research Use Only!
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
493
Applicable Applications for anti-FSCN1 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Fascin Picoband antibody, MBS177840, Western blottingAll lanes: Anti Fascin (MBS177840) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: SKOV Whole Cell Lysate at 40ugPredicted bind size: 55KDObserved bind size: 55KD)

Western Blot (WB) (Anti- Fascin Picoband antibody, MBS177840, Western blottingAll lanes: Anti Fascin (MBS177840) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: SKOV Whole Cell Lysate at 40ugPredicted bind size: 55KDObserved bind size: 55KD)
Related Product Information for anti-FSCN1 antibody
Description: Rabbit IgG polyclonal antibody for Fascin(FSCN1) detection. Tested with WB in Human;Rat.

Background: Fascin is an actin cross-linking protein. The Fascin gene contains 5 exons and spans 7 kb. It is a 54-58 kilodalton monomeric actin filament bundling protein originally isolated from sea urchin egg but also found in Drosophila and vertebrates, including humans. Fascin (from the Latin for bundle) is spaced at 11 nanometre intervals along the filament. The bundles in cross section are seen to be hexagonally packed, and the longitudinal spacing is compatible with a model where fascin cross-links at alternating 4 and 5 actins. It is calcium insensitive and monomeric. Fascin binds beta-catenin, and colocalizes with it at the leading edges and borders of epithelial and endothelial cells. The role of Fascin in regulating cytoskeletal structures for the maintenance of cell adhesion, coordinating motility and invasion through interactions with signalling pathways is an active area of research especially from the cancer biology perspective. Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer.
References
1. Saishin, Y., Shimada, S., Morimura, H., Sato, K., Ishimoto, I., Tano, Y., Tohyama, M.Isolation of a cDNA encoding a photoreceptor cell-specific actin-bundling protein: retinal fascin.FEBS Lett. 414: 381-386, 1997. 2. Wada, Y., Abe, T., Takeshita, T., Sato, H., Yanashima, K., Tamai, M.Mutation of human retinal fascin gene (FSCN2) causes autosomal dominant retinitis pigmentosa.Invest. Ophthal. Vis. Sci. 42: 2395-2400, 2001.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,530 Da
NCBI Official Full Name
fascin
NCBI Official Synonym Full Names
fascin actin-bundling protein 1
NCBI Official Symbol
FSCN1
NCBI Official Synonym Symbols
HSN; SNL; p55; FAN1
NCBI Protein Information
fascin
UniProt Protein Name
Fascin
Protein Family
UniProt Gene Name
FSCN1
UniProt Synonym Gene Names
FAN1; HSN; SNL
UniProt Entry Name
FSCN1_HUMAN

NCBI Description

This gene encodes a member of the fascin family of actin-binding proteins. Fascin proteins organize F-actin into parallel bundles, and are required for the formation of actin-based cellular protrusions. The encoded protein plays a critical role in cell migration, motility, adhesion and cellular interactions. Expression of this gene is known to be regulated by several microRNAs, and overexpression of this gene may play a role in the metastasis of multiple types of cancer by increasing cell motility. Expression of this gene is also a marker for Reed-Sternberg cells in Hodgkin's lymphoma. A pseudogene of this gene is located on the long arm of chromosome 15. [provided by RefSeq, Sep 2011]

Uniprot Description

Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration.

Research Articles on FSCN1

Similar Products

Product Notes

The FSCN1 fscn1 (Catalog #AAA177840) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Fascin Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Fascin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the FSCN1 fscn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Fascin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.