Rabbit anti-Human, Mouse FAM3B Polyclonal Antibody | anti-FAM3B antibody

FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11) (HRP)

Cat. Num. AAA6378068

• Gene Names: FAM3B; 2-21; ORF9; PANDER; PRED44; C21orf11; C21orf76
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FAM3B; Polyclonal Antibody; FAM3B (Protein FAM3B; Cytokine-like Protein 2-21; Pancreatic-derived Factor; PANDER; UNQ320/PRO365; PRED44; C21orf76; C21orf11) (HRP); anti-FAM3B antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human FAM3B. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-FAM3B antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human FAM3B, aa1-235 (NP_478066.3).
• Immunogen Sequence: MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FAM3B rabbit polyclonal antibody. Western Blot analysis of FAM3B expression in mouse intestine.)

Western Blot (WB)

(Western Blot analysis of FAM3B expression in transfected 293T cell line by FAM3B polyclonal antibody. Lane 1: FAM3B transfected lysate (26kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-FAM3B antibody

FAM3B has delayed effects on beta-cell function, inhibiting basal insulin secretion from a beta-cell line in a dose-dependent manner.

Product Categories/Family for anti-FAM3B antibody

Antibodies; FAM

NCBI and Uniprot Product Information

• NCBI GI #: 46255030
• NCBI GeneID: 54097
• NCBI Accession #: NP_478066.3
• NCBI GenBank Nucleotide #: NM_058186
• UniProt Accession #: P58499
• Molecular Weight: 20,815 Da
• NCBI Official Full Name: protein FAM3B isoform a
• NCBI Official Synonym Full Names: family with sequence similarity 3, member B
• NCBI Official Symbol: FAM3B
• NCBI Official Synonym Symbols: 2-21; ORF9; PANDER; PRED44; C21orf11; C21orf76
• NCBI Protein Information: protein FAM3B; D21M16SJHU19e; cytokine-like protein 2-21; pancreatic derived factor; pancreatic-derived factor
• UniProt Protein Name: Protein FAM3B
• Protein Family: Protein
• UniProt Gene Name: FAM3B
• UniProt Synonym Gene Names: C21orf11; C21orf76; PANDER
• UniProt Entry Name: FAM3B_HUMAN

Uniprot Description

FAM3B: Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner. Present in insulin secretory granules and likely cosecreted with insulin. Belongs to the FAM3 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Nuclear envelope; Secreted, signal peptide; Apoptosis; Cytokine

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: extracellular space; extracellular region

Molecular Function: cytokine activity

Biological Process: insulin secretion; apoptosis