Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FAM36A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Rabbit FAM36A Polyclonal Antibody | anti-COX20 antibody

FAM36A antibody - C-terminal region

Gene Names
COX20; FAM36A
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FAM36A; Polyclonal Antibody; FAM36A antibody - C-terminal region; anti-COX20 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN
Sequence Length
118
Applicable Applications for anti-COX20 antibody
Western Blot (WB)
Protein Size (# AA)
118 amino acids
Protein Interactions
UBC;
Blocking Peptide
For anti-COX20 (MBS3211319) antibody is Catalog MBS3236271
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FAM36A
Predicted Homology
Horse: 79%; Human: 100%; Mouse: 90%; Rabbit: 79%; Rat: 90%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FAM36A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-FAM36A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-COX20 antibody
This is a rabbit polyclonal antibody against FAM36A. It was validated on Western Blot

Target Description: FAM36A is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of FAM36A remains unknown.
Product Categories/Family for anti-COX20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13kDa
NCBI Official Full Name
cytochrome c oxidase assembly protein COX20, mitochondrial isoform 1
NCBI Official Synonym Full Names
cytochrome c oxidase assembly factor COX20
NCBI Official Symbol
COX20
NCBI Official Synonym Symbols
FAM36A
NCBI Protein Information
cytochrome c oxidase assembly protein COX20, mitochondrial
UniProt Protein Name
Cytochrome c oxidase protein 20 homolog
UniProt Gene Name
COX20
UniProt Synonym Gene Names
FAM36A
UniProt Entry Name
COX20_HUMAN

NCBI Description

This gene encodes a protein that plays a role in the assembly of cytochrome C oxidase, an important component of the respiratory pathway. It contains two transmembrane helices and localizes to the mitochondrial membrane. Mutations in this gene can cause mitochondrial complex IV deficiency, which results in ataxia and muscle hypotonia. There are multiple pseudogenes for this gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]

Research Articles on COX20

Similar Products

Product Notes

The COX20 cox20 (Catalog #AAA3211319) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM36A antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAM36A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COX20 cox20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGCWFHCRYN YAKQRIQERI AREEIKKKIL YEGTHLDPER KHNGSSSN. It is sometimes possible for the material contained within the vial of "FAM36A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.