Western Blot (WB)
(Host: RabbitTarget Name: FAM162ASample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human FAM162A Polyclonal Antibody | anti-FAM162A antibody
FAM162A Antibody - middle region
Gene Names
FAM162A; E2IG5; HGTD-P; C3orf28
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FAM162A; Polyclonal Antibody; FAM162A Antibody - middle region; anti-FAM162A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDW
Sequence Length
154
Applicable Applications for anti-FAM162A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FAM162A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: FAM162ASample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: FAM162ASample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-FAM162A antibody
Proposed to be involved in regulation of apoptosis; the exact mechanism may differ between cell types/tissues. May be involved in hypoxia-induced cell death of transformed cells implicating cytochrome C release and caspase activation (such as CASP9) and inducing mitochondrial permeability transition. May be involved in hypoxia-induced cell death of neuronal cells probably by promoting release of AIFM1 from mitochondria to cytoplasm and its translocation to the nucleus; however, the involvement of caspases has been reported conflictingly.
Product Categories/Family for anti-FAM162A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16 kDa
NCBI Official Full Name
protein FAM162A
NCBI Official Synonym Full Names
family with sequence similarity 162 member A
NCBI Official Symbol
FAM162A
NCBI Official Synonym Symbols
E2IG5; HGTD-P; C3orf28
NCBI Protein Information
protein FAM162A
UniProt Protein Name
Protein FAM162A
Protein Family
UniProt Gene Name
FAM162A
UniProt Synonym Gene Names
C3orf28; E2IG5; HGTD-P
Uniprot Description
Proposed to be involved in regulation of apoptosis; the exact mechanism may differ between cell types/tissues. May be involved in hypoxia-induced cell death of transformed cells implicating cytochrome C release and caspase activation (such as CASP9) and inducing mitochondrial permeability transition. May be involved in hypoxia-induced cell death of neuronal cells probably by promoting release of AIFM1 from mitochondria to cytoplasm and its translocation to the nucleus; however, the involvement of caspases has been reported conflictingly.
Research Articles on FAM162A
Similar Products
Product Notes
The FAM162A fam162a (Catalog #AAA3222776) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM162A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAM162A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FAM162A fam162a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LCERDVSSSL RLTRSSDLKR INGFCTKPQE SPGAPSRTYN RVPLHKPTDW. It is sometimes possible for the material contained within the vial of "FAM162A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
