Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NRBF2Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NRBF2 Polyclonal Antibody | anti-NRBF2 antibody

NRBF2 Antibody - middle region

Gene Names
NRBF2; COPR; COPR1; COPR2; NRBF-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NRBF2; Polyclonal Antibody; NRBF2 Antibody - middle region; anti-NRBF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPP
Sequence Length
287
Applicable Applications for anti-NRBF2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NRBF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NRBF2Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NRBF2Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NRBF2 antibody
May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro). Involved in starvation-induced autophagy probably by its association with PI3K complex I (PI3KC3-C1). However, effects has been described variably. Involved in the induction of starvation-induced autophagy. Stabilzes PI3KC3-C1 assembly and enhances ATG14-linked lipid kinase activity of PIK3C3. Proposed to negatively regulate basal and starvation-induced autophagy and to inhibit PIK3C3 activity by modulating interactions in PI3KC3-C1. May be involved in autophagosome biogenesis. May play a role in neural progenitor cell survival during differentiation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
nuclear receptor-binding factor 2 isoform 2
NCBI Official Synonym Full Names
nuclear receptor binding factor 2
NCBI Official Symbol
NRBF2
NCBI Official Synonym Symbols
COPR; COPR1; COPR2; NRBF-2
NCBI Protein Information
nuclear receptor-binding factor 2
UniProt Protein Name
Nuclear receptor-binding factor 2
UniProt Gene Name
NRBF2
UniProt Synonym Gene Names
COPR; NRBF-2
UniProt Entry Name
NRBF2_HUMAN

Uniprot Description

NRBF2: May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro). Interacts with PPARA, PPARD and PPARG. Interacts with RARA, RARG and RXRA in the presence of bound ligand. Detected in keratinocytes, liver and placenta. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Autophagy; Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 10q21.3

Cellular Component: nucleoplasm; cytoplasm

Biological Process: transcription initiation from RNA polymerase II promoter; regulation of transcription, DNA-dependent; gene expression

Research Articles on NRBF2

Similar Products

Product Notes

The NRBF2 nrbf2 (Catalog #AAA3222806) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NRBF2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NRBF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NRBF2 nrbf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EFLVAENERL RKENKQLKAE KARLLKGPIE KELDVDADFV ETSELWSLPP. It is sometimes possible for the material contained within the vial of "NRBF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.