Immunohistochemistry (IHC)
(Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-FAIM antibody )
Rabbit FAIM Polyclonal Antibody | anti-FAIM antibody
FAIM antibody - N-terminal region
Gene Names
FAIM; FAIM1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
FAIM; Polyclonal Antibody; FAIM antibody - N-terminal region; anti-FAIM antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG
Sequence Length
213
Applicable Applications for anti-FAIM antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FAIM
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-FAIM antibody )
Immunohistochemistry (IHC)
(Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-FAIM antibody )
Western Blot (WB)
(WB Suggested Anti-FAIM Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-FAIM Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-FAIM antibody
This is a rabbit polyclonal antibody against FAIM. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.
Target Description: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.
Product Categories/Family for anti-FAIM antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
fas apoptotic inhibitory molecule 1 isoform a
NCBI Official Synonym Full Names
Fas apoptotic inhibitory molecule
NCBI Official Symbol
FAIM
NCBI Official Synonym Symbols
FAIM1
NCBI Protein Information
fas apoptotic inhibitory molecule 1
UniProt Protein Name
Fas apoptotic inhibitory molecule 1
Protein Family
UniProt Gene Name
FAIM
UniProt Synonym Gene Names
FAIM1
UniProt Entry Name
FAIM1_HUMAN
NCBI Description
The protein encoded by this gene protects against death receptor-triggered apoptosis and regulates B-cell signaling and differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]
Uniprot Description
FAIM: Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells. Belongs to the FAIM1 family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Apoptosis
Chromosomal Location of Human Ortholog: 3q22.3
Cellular Component: cytoplasm
Biological Process: apoptosis; negative regulation of apoptosis
Research Articles on FAIM
Similar Products
Product Notes
The FAIM faim (Catalog #AAA3212648) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAIM antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FAIM can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the FAIM faim for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTDLVAVWDV ALSDGVHKIE FEHGTTSGKR VVYVDGKEEI RKEWMFKLVG. It is sometimes possible for the material contained within the vial of "FAIM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
