Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FABP6 expression in transfected 293T cell line by FABP6 polyclonal antibody. Lane 1: FABP6 transfected lysate (14.19kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human FABP6 Polyclonal Antibody | anti-FABP6 antibody

FABP6 (Intestinal Bile Acid-binding Protein, I-BABP, Intestinal 15kD Protein, I-15P, Ileal Lipid-binding Protein, ILBP, Fatty Acid-binding Protein 6, Gastrotropin, GT, ILBP, ILLBP)

Gene Names
FABP6; ILBP; I-15P; I-BAP; ILBP3; ILLBP; I-BABP; I-BALB
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FABP6; Polyclonal Antibody; FABP6 (Intestinal Bile Acid-binding Protein; I-BABP; Intestinal 15kD Protein; I-15P; Ileal Lipid-binding Protein; ILBP; Fatty Acid-binding Protein 6; Gastrotropin; GT; ILLBP); Anti -FABP6 (Intestinal Bile Acid-binding Protein; anti-FABP6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FABP6.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Applicable Applications for anti-FABP6 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human FABP6, aa1-129 (AAH22489).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FABP6 expression in transfected 293T cell line by FABP6 polyclonal antibody. Lane 1: FABP6 transfected lysate (14.19kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FABP6 expression in transfected 293T cell line by FABP6 polyclonal antibody. Lane 1: FABP6 transfected lysate (14.19kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FABP6 antibody
FABP6 is the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
Product Categories/Family for anti-FABP6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
14,371 Da
NCBI Official Full Name
FABP6
NCBI Official Synonym Full Names
fatty acid binding protein 6, ileal
NCBI Official Symbol
FABP6
NCBI Official Synonym Symbols
ILBP; I-15P; I-BAP; ILBP3; ILLBP; I-BABP; I-BALB
NCBI Protein Information
gastrotropin; GT; intestinal 15 kDa protein; ileal lipid-binding protein; illeal lipid-binding protein; ileal bile acid binding protein
UniProt Protein Name
Gastrotropin
Protein Family
UniProt Gene Name
FABP6
UniProt Synonym Gene Names
ILBP; ILLBP; GT; ILBP; I-15P; I-BABP
UniProt Entry Name
FABP6_HUMAN

NCBI Description

This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

FABP6: Ileal protein which stimulates gastric acid and pepsinogen secretion. Seems to be able to bind to bile salts and bilirubins. Isoform 2 is essential for the survival of colon cancer cells to bile acid-induced apoptosis. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. 2 isoforms of the human protein are produced by alternative promoter.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 5q33.3-q34

Cellular Component: cytoplasm; cytosol

Molecular Function: transporter activity; lipid binding

Biological Process: bile acid and bile salt transport; negative regulation of cell proliferation; bile acid metabolic process; lipid metabolic process; transmembrane transport

Research Articles on FABP6

Similar Products

Product Notes

The FABP6 fabp6 (Catalog #AAA6007827) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FABP6 (Intestinal Bile Acid-binding Protein, I-BABP, Intestinal 15kD Protein, I-15P, Ileal Lipid-binding Protein, ILBP, Fatty Acid-binding Protein 6, Gastrotropin, GT, ILBP, ILLBP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FABP6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the FABP6 fabp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAFTGKFEME SEKNYDEFMK LLGISSDVIE KAHNFKIVTE VQQDGQDFTW SQHYYGGHTM TNKFTVGKES NIQTMGGKTF KATVQMEGGK LVVNFPNYHQ TSEIVGDKLV EVSTIGGVTY ERVSKRLA. It is sometimes possible for the material contained within the vial of "FABP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.